y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.009G138200.5
FamilyCE16
Protein PropertiesLength: 232 Molecular Weight: 25108.8 Isoelectric Point: 8.74
ChromosomeChromosome/Scaffold: 09 Start: 10441591 End: 10443428
DescriptionGDSL-like Lipase/Acylhydrolase superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE1672232.8e-27
  ITLTQQLEYFKEYQAKLAKVAGSTKSASITKDALYVLSAGSGDFLQNYYVNPLLNHAYTPDQYGSFLIDTFTNFVKNLYGLGARKIGVTSLPPLGCVPLA
  RALFGYHEKGCISRFNTDAQQFNKKLNAAAANLQKQHPGLKIVVFDIFKALYDIVKSPSNYGFVEATKGCCGTGTVETTAFLCNPKAPGTCSNASQYVFW
  DSVHPSQAANQVLADAL
Full Sequence
Protein Sequence     Length: 232     Download
MFLQHAITLT QQLEYFKEYQ AKLAKVAGST KSASITKDAL YVLSAGSGDF LQNYYVNPLL    60
NHAYTPDQYG SFLIDTFTNF VKNLYGLGAR KIGVTSLPPL GCVPLARALF GYHEKGCISR    120
FNTDAQQFNK KLNAAAANLQ KQHPGLKIVV FDIFKALYDI VKSPSNYGFV EATKGCCGTG    180
TVETTAFLCN PKAPGTCSNA SQYVFWDSVH PSQAANQVLA DALIVQGIAL I*            240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd01847Triacylglycerol_lipase_like6.0e-1130221200+
COG3240COG32409.0e-1739224186+
cd01846fatty_acyltransferase_like6.0e-2635223189+
PLN03156PLN031563.0e-647224220+
cd01837SGNH_plant_lipase_like1.0e-792224223+
Gene Ontology
GO TermDescription
GO:0006629lipid metabolic process
GO:0016788hydrolase activity, acting on ester bonds
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABK95990.103231124351unknown [Populus trichocarpa]
GenBankACU20309.103231124352unknown [Glycine max]
GenBankACU24285.103231125353unknown [Glycine max]
RefSeqXP_002298249.10323198325predicted protein [Populus trichocarpa]
RefSeqXP_002515932.102231124353zinc finger protein, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3kvn_A0.00000238221147310X Chain X, Crystal Structure Of The Full-Length Autotransporter Esta From Pseudomonas Aeruginosa
PDB3kvn_X0.00000238221147310X Chain X, Crystal Structure Of The Full-Length Autotransporter Esta From Pseudomonas Aeruginosa
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
ES82710323122320
ES83195723122320
JG45322923122320
CO12427722422250
AI72679422422250
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_051_00086.2Aquca_051_00088.1Aquca_019_00111.1Aquca_009_01045.1Aquca_020_00377.1
Aquca_075_00042.1Aquca_020_00377.2Aquca_028_00063.1Aquca_009_00480.1Aquca_003_00337.1
Aquca_028_00065.1Aquca_028_00064.1Aquca_026_00214.1Aquca_005_00130.3Aquca_005_00130.1
Aquca_051_00091.1Aquca_015_00423.1
Arabidopsis lyrata906695311764479089492123884658
899264316515862643316514494383
321717332543476497476744316517.110.326
Arabidopsis thalianaAT1G20132.1AT1G06990.1AT1G20130.2AT1G20130.1AT3G16370.1
AT2G40250.1AT5G03810.1AT5G03820.1AT5G42170.1AT4G26790.2
AT4G26790.1AT2G04570.1AT1G58430.1AT1G75900.1AT5G22810.1
AT1G75890.1AT1G75890.2AT1G75880.1AT1G75880.2AT1G20120.1
AT5G45950.1AT1G73610.1AT1G23500.1AT1G20135.1AT1G75920.4
AT1G75920.2AT1G75920.1AT1G75910.1AT1G75930.1
Brachypodium distachyonBradi2g22690.1Bradi4g27017.1Bradi1g50970.1Bradi1g50927.1Bradi1g12350.1
Bradi1g35340.1Bradi3g27407.1Bradi4g08597.1Bradi2g54060.1Bradi2g53830.1
Bradi3g00310.1
Brassica rapaBra004974Bra025794.569.881Bra025794.569.881Bra017022Bra012377
Bra040686Bra031550Bra027168Bra003736Bra013200
Bra026402Bra035295Bra020216Bra021725Bra015802
Bra016475Bra015804Bra012211Bra015803Bra003737
Bra022002Bra024605Bra025794.333.555Bra025794.333.555Bra012212
Carica papayaevm.model.supercontig_25.31evm.model.supercontig_47.41evm.model.supercontig_284.8evm.model.supercontig_132.39evm.model.supercontig_132.40
evm.model.supercontig_7.35evm.model.supercontig_6.291evm.model.supercontig_25.30evm.model.supercontig_26.293evm.model.supercontig_2.350
evm.model.supercontig_26.291
Capsella rubellaCarubv10011073mCarubv10012021mCarubv10028437mCarubv10017544mCarubv10014074m
Carubv10014077mCarubv10005151mCarubv10005150mCarubv10025193mCarubv10011033m
Carubv10020529mCarubv10003031mCarubv10012178mCarubv10021812mCarubv10020390m
Carubv10026665mCarubv10025096mCarubv10022025mCarubv10028290mCarubv10012369m
Carubv10021387m
Citrus clementinaCiclev10001578mCiclev10025938mCiclev10026212mCiclev10031929mCiclev10003119m
Ciclev10015771mCiclev10025900mCiclev10025957mCiclev10008798mCiclev10031968m
Ciclev10015728mCiclev10001561mCiclev10026202m
Citrus sinensisorange1.1g019497morange1.1g018227morange1.1g023164morange1.1g017687morange1.1g042648m
orange1.1g018664morange1.1g018844morange1.1g019347morange1.1g018245morange1.1g018232m
orange1.1g018209morange1.1g018195m
Cucumis sativusCucsa.139530.1Cucsa.021660.1Cucsa.139540.1Cucsa.185150.1Cucsa.385520.1
Cucsa.073330.1Cucsa.393990.1Cucsa.043810.1Cucsa.046680.1
Eucalyptus grandisEucgr.F03501.1Eucgr.F03090.1Eucgr.B03904.1Eucgr.A01085.1Eucgr.A01086.1
Eucgr.I02326.1Eucgr.F01671.1Eucgr.J02472.2Eucgr.D00574.1Eucgr.J02469.1
Eucgr.J02470.1Eucgr.J02472.1Eucgr.H00933.1Eucgr.H00934.1
Fragaria vescamrna21011.1-v1.0-hybridmrna14562.1-v1.0-hybridmrna26512.1-v1.0-hybridmrna14563.1-v1.0-hybridmrna25695.1-v1.0-hybrid
mrna28753.1-v1.0-hybridmrna14567.1-v1.0-hybridmrna08561.1-v1.0-hybridmrna08560.1-v1.0-hybridmrna14406.1-v1.0-hybrid
Glycine maxGlyma11g19600.2Glyma02g39800.2Glyma02g39820.1Glyma13g30680.3Glyma06g02520.1
Glyma04g02480.1Glyma07g01680.1Glyma08g21340.1Glyma13g42960.1Glyma06g44950.2
Glyma11g08420.3Glyma11g08420.2Glyma06g44970.1Glyma02g05150.1Glyma16g23290.1
Glyma11g19600.3Glyma11g19600.1Glyma17g37920.1Glyma02g05210.1Glyma14g40200.1
Glyma17g37930.1Glyma15g08600.1Glyma16g23260.2Glyma17g37910.1Glyma02g43180.1
Glyma14g40220.1
Gossypium raimondiiGorai.010G002200.1Gorai.009G138200.2Gorai.009G138200.7Gorai.009G138200.1Gorai.009G138200.9
Gorai.009G138200.3Gorai.009G138200.8Gorai.001G118700.1Gorai.011G070000.2Gorai.001G211300.1
Gorai.011G070000.3Gorai.003G108700.2Gorai.003G108700.1Gorai.010G002300.1Gorai.011G070000.1
Gorai.009G138200.6Gorai.009G192700.1Gorai.001G217800.1Gorai.007G169400.1Gorai.013G157800.1
Gorai.009G165200.2Gorai.009G165200.1Gorai.012G079700.1
Linum usitatissimumLus10034541Lus10026406Lus10028423Lus10008639Lus10035585
Lus10040791Lus10006856Lus10037598Lus10041877Lus10006855
Lus10013572Lus10003717Lus10028424Lus10029958Lus10013956
Lus10034540Lus10005279Lus10034542Lus10003720Lus10028425
Lus10026074
Malus domesticaMDP0000310487MDP0000202137MDP0000137339MDP0000928830MDP0000168305
MDP0000132214MDP0000546054MDP0000150756MDP0000146939MDP0000317158
MDP0000250901MDP0000175342MDP0000270993MDP0000261876MDP0000291231
MDP0000151291MDP0000151161MDP0000174332MDP0000918407MDP0000255794
MDP0000158653MDP0000949017MDP0000617020MDP0000146006MDP0000120560
Manihot esculentacassava4.1_024022mcassava4.1_010784mcassava4.1_010676mcassava4.1_010329mcassava4.1_021526m
cassava4.1_009843mcassava4.1_027640mcassava4.1_028090mcassava4.1_010562mcassava4.1_027779m
Medicago truncatulaMedtr5g074270.1Medtr5g083040.1Medtr1g025700.1Medtr8g014910.1Medtr2g100620.1
Medtr5g022630.1Medtr5g084750.1Medtr5g084790.1Medtr5g022640.1Medtr1g025780.1
Medtr8g075220.1Medtr8g075200.1Medtr8g075230.1Medtr1g025720.1Medtr3g114090.1
Medtr1g025760.1Medtr1g025680.1Medtr3g114120.1
Mimulus guttatusmgv1a009146mmgv1a009432mmgv1a025165mmgv1a023444mmgv1a009257m
mgv1a008997mmgv1a026832mmgv1a008769mmgv1a026265mmgv1a022118m
mgv1a009073mmgv1a008691mmgv11b017326m
Oryza sativaLOC_Os09g04710.2LOC_Os09g07290.1LOC_Os06g05550.1LOC_Os03g47940.1LOC_Os06g05630.1
LOC_Os09g04624.1LOC_Os09g04710.1LOC_Os02g09610.1LOC_Os06g43044.1LOC_Os01g61570.1
LOC_Os05g39220.1LOC_Os01g61200.1LOC_Os02g01140.1LOC_Os10g05088.1
Panicum virgatumPavirv00008337mPavirv00000261mPavirv00038024mPavirv00061519mPavirv00069761m
Pavirv00025663mPavirv00009013mPavirv00054177mPavirv00056235mPavirv00067881m
Pavirv00015386mPavirv00009930mPavirv00028004mPavirv00022742mPavirv00041979m
Pavirv00068226mPavirv00065272mPavirv00024442mPavirv00018906mPavirv00059280m
Pavirv00002050mPavirv00000501mPavirv00053952mPavirv00027728m
Physcomitrella patensPp1s35_26V6.1Pp1s199_62V6.1Pp1s52_15V6.1Pp1s306_55V6.1
Phaseolus vulgarisPhvul.003G013500.1Phvul.009G018300.1Phvul.010G143600.1Phvul.005G164800.1Phvul.011G118200.1
Phvul.002G106300.1Phvul.008G215600.1Phvul.008G215500.1Phvul.011G088700.1Phvul.003G265600.1
Phvul.001G004400.1Phvul.009G018100.1Phvul.003G265500.1Phvul.006G179500.1Phvul.001G004500.1
Picea abiesMA_127685g0010MA_103942g0010MA_166543g0010MA_92286g0010MA_9037505g0010
MA_95274g0010MA_58098g0010MA_27394g0010MA_95656g0010MA_10425922g0010
MA_77591g0010MA_429323g0010MA_8087g0010MA_201164g0010MA_10224291g0010
MA_10223491g0010MA_345345g0010
Populus trichocarpaPotri.008G076600.1Potri.009G151000.1Potri.001G191400.1Potri.005G205100.1Potri.005G242800.2
Potri.005G242800.1Potri.013G153000.1Potri.002G018800.1Potri.006G144400.1Potri.004G051900.1
Prunus persicappa026294mppa007967mppa007650mppa007953mppa007979m
ppa020405mppa008001mppa009528mppa023913mppa009531m
ppa017759mppa007642mppa009721m
Ricinus communis30190.m01129729991.m00062430146.m00347529620.m00055029640.m000407
30170.m014261.465.69830170.m014261.465.69829900.m00156329814.m00074530170.m014261.105.341
30170.m014261.105.341
Setaria italicaSi015739mSi036350mSi006758mSi006760mSi030253m
Si017624mSi030338mSi006691mSi022485mSi031143m
Si032305mSi002061mSi017542mSi006463mSi025090m
Selaginella moellendorffii8992142699743876879568
Sorghum bicolorSb01g026440.1Sb01g011850.1Sb10g003340.1Sb10g003420.1Sb10g024910.1
Sb08g021590.1Sb01g027030.1Sb02g012990.1Sb06g019980.1Sb02g031310.1
Sb01g021130.1Sb01g000430.1Sb03g038590.1Sb04g000310.1Sb09g023010.1
Sb02g002860.1
Thellungiella halophilaThhalv10008023mThhalv10007871mThhalv10008013mThhalv10007885mThhalv10008086m
Thhalv10010500mThhalv10021008mThhalv10025598mThhalv10018754mThhalv10002592m
Thhalv10007776mThhalv10018728mThhalv10000940mThhalv10005274mThhalv10019814m
Thhalv10018807mThhalv10019865m
Vitis viniferaGSVIVT01016949001GSVIVT01009961001GSVIVT01009962001GSVIVT01009963001GSVIVT01009959001
GSVIVT01009960001GSVIVT01009957001GSVIVT01009958001GSVIVT01016950001GSVIVT01021149001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)