y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.009G141300.3
FamilyGH35
Protein PropertiesLength: 666 Molecular Weight: 74476.7 Isoelectric Point: 9.2916
ChromosomeChromosome/Scaffold: 09 Start: 10702118 End: 10710740
Descriptionbeta-galactosidase 17
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH35884110
  FWKDGKPFQIIGGDLHYFRVLPEYWEDRLLRAKALGLNTIQTYIPWNLHEPEAGKLVFEGIADLVSFLKLCQKLGLLVMLRAGPYICAEWDLGGFPAWLL
  SIHPDVRLRSSDPAYLQKVEGWWGVLLPKVAPLLYGNGGPIIMVQIENEFGSYGNDKAYLSHLVKLARGHLGEDIILYTTDGGSRETLEKGTIQGDGVFA
  AVDFTTGDNPWPIFKLQKQFNSPGKSPPLSSEFYTGWLTHWSEKMARTDADFTAAALEKIMLQNGSVVLYMAHGGTNFGFYNGANTGADESDYKPDLTSY
  DYDAPITESGDVDNAKFKAIRRVV
Full Sequence
Protein Sequence     Length: 666     Download
MNRSKSLAAT SKSITAMARK QSSKTMLIFF LLLSLLAFLS FLPVFASLPS LPSYSHSYDL    60
HFHLPRHQRL HRRQKIGVRK FEIAEDKFWK DGKPFQIIGG DLHYFRVLPE YWEDRLLRAK    120
ALGLNTIQTY IPWNLHEPEA GKLVFEGIAD LVSFLKLCQK LGLLVMLRAG PYICAEWDLG    180
GFPAWLLSIH PDVRLRSSDP AYLQKVEGWW GVLLPKVAPL LYGNGGPIIM VQIENEFGSY    240
GNDKAYLSHL VKLARGHLGE DIILYTTDGG SRETLEKGTI QGDGVFAAVD FTTGDNPWPI    300
FKLQKQFNSP GKSPPLSSEF YTGWLTHWSE KMARTDADFT AAALEKIMLQ NGSVVLYMAH    360
GGTNFGFYNG ANTGADESDY KPDLTSYDYD APITESGDVD NAKFKAIRRV VGKFSSVSLP    420
SLPPNNKKTG YGSIQLKRTA FLFDLLDEID PLHIVEAESP TAMEYLNQMF GFVLYVSEYA    480
AKTGGSKLVI PKVHDRAQVF ISCSPEVNGG QVSYVGTIER WSNQAINLPN VKCVSSTSLF    540
ILVENMGRVN YGPYIFDRKG ILSSVYVDGS VLKRWKMISI PFHNLNEVPK FNPVIQVTSK    600
FHKVSAGKKL EHNSGMSQEH KKHAVSNGRT LLPTVQFFVH LTLLLYTSLP SKSNGHKPWC    660
DIIIF*                                                               720
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3250LacZ0.00037416699+
pfam02449Glyco_hydro_423.0e-10101238155+
COG1874LacA3.0e-3786399347+
PLN03059PLN030593.0e-4497408321+
pfam01301Glyco_hydro_354.0e-16188414327+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004565beta-galactosidase activity
GO:0005975carbohydrate metabolic process
GO:0009341beta-galactosidase complex
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI35958.10562413619unnamed protein product [Vitis vinifera]
RefSeqNP_001031273.1010661126527BGAL17 (beta-galactosidase 17); beta-galactosidase/ catalytic/ cation binding [Arabidopsis thaliana]
RefSeqNP_565051.107261154589BGAL17 (beta-galactosidase 17); beta-galactosidase/ catalytic/ cation binding [Arabidopsis thaliana]
RefSeqXP_002280228.107962449595PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002327549.10796111540predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3thd_D0795807491A Chain A, Crystal Structure Of Human Beta-Galactosidase In Complex With Galactose
PDB3thd_C0795807491A Chain A, Crystal Structure Of Human Beta-Galactosidase In Complex With Galactose
PDB3thd_B0795807491A Chain A, Crystal Structure Of Human Beta-Galactosidase In Complex With Galactose
PDB3thd_A0795807491A Chain A, Crystal Structure Of Human Beta-Galactosidase In Complex With Galactose
PDB3thc_D0795807491A Chain A, Crystal Structure Of Human Beta-Galactosidase In Complex With Galactose
Transmembrane Domains
StartEnd
2648
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO0913062871614470
CO1233882693466140
DY905780286763610
DY939729283763580
ES82378232413240
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_020_00429.1
Arabidopsis lyrata877397
Arabidopsis thalianaAT1G72990.2AT1G72990.1
Brachypodium distachyonBradi2g18440.2Bradi2g18440.3
Brassica rapaBra003861
Carica papayaevm.model.supercontig_1398.1evm.model.supercontig_25.44
Capsella rubellaCarubv10022320m
Citrus clementinaCiclev10024990mCiclev10024996m
Citrus sinensisorange1.1g011205morange1.1g006708morange1.1g006713morange1.1g006715morange1.1g006845m
orange1.1g007259morange1.1g009269morange1.1g011211m
Cucumis sativusCucsa.341150.1
Eucalyptus grandisEucgr.J02679.1Eucgr.J02852.1
Fragaria vescamrna23038.1-v1.0-hybrid
Glycine maxGlyma13g42560.1Glyma13g42560.2
Gossypium raimondiiGorai.008G075700.1Gorai.008G075700.2Gorai.009G141300.1Gorai.009G141300.2
Linum usitatissimumLus10015616Lus10037634
Malus domesticaMDP0000944874MDP0000921848
Manihot esculentacassava4.1_026281mcassava4.1_034020m
Medicago truncatulaMedtr2g100000.1
Mimulus guttatusmgv1a002369m
Oryza sativaLOC_Os05g46200.2LOC_Os05g46200.1LOC_Os05g46200.3
Panicum virgatumPavirv00010551mPavirv00046579m
Physcomitrella patensPp1s149_266V6.1Pp1s52_244V6.1Pp1s52_244V6.2
Phaseolus vulgarisPhvul.005G158700.1
Picea abiesMA_775331g0010MA_8535581g0010
Populus trichocarpaPotri.003G040000.1Potri.003G037000.1
Prunus persicappa002232m
Ricinus communis28694.m000663.153.29928694.m000663.153.29928694.m000663.62.15328694.m000663.62.153
Setaria italicaSi021395mSi021403m
Selaginella moellendorffii61485
Sorghum bicolorSb09g026870.1
Thellungiella halophilaThhalv10018211m
Vitis viniferaGSVIVT01016865001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny