y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.009G233800.1
FamilyGH13
Protein PropertiesLength: 775 Molecular Weight: 87570.3 Isoelectric Point: 6.6911
ChromosomeChromosome/Scaffold: 09 Start: 18441327 End: 18452290
Descriptionisoamylase 3
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH132666310
  DIRGTYAGLIEKIPHLLELGINAVELLPVFEFDEFEFQRRPNPRDHMINTWGYSTINFFAPMSRYGSGGGGAVSASREFKEMVKALHGAGIEVILDVVYN
  HTNEADDKHPYTTSFRGIDNKVYYMVDLNNKGQLLNFSGCGNTFNCNHPVVMELIIDSLRHWVVEYHIDGFRFDLASVLCRGTDGSPLGAPPLIRAIAKD
  ATLSRCKIIAEPWDCGGLYLVGSFPNWDRWAEWNGKYRDDLRRFIKGDPGMKGAFATRVSGSADLYRKNKRKPYHSVNFVIAHDGFTLRDLVSYNFKHNE
  ANGEGGNDGSNDNFSWNCGFEGETDNVDIIALRFRQMKNFHLALMVSQGVPMMLMGDEYGHTRYGN
Full Sequence
Protein Sequence     Length: 775     Download
MLHSSFISKS NGTKFPSFAS ANATLSSFRA SSHFQMGLKW SRIAFSSSSG QRLSSKARSR    60
VKHRTANVYG RQARERVLEE EAPEMAEATP SFKIFPGQAF PLGASEVDNG INFAIFSQHA    120
TAVTLCLSLP QRGELDMLAG GMIEFSLDPN LNKTGDIWHI CIEDLPRSNV LYGYRIDGPK    180
DWDKGHRFDS NNVLIDPYAK LVEGRRNFGD AKHKLSKFLG TYDFDSLPFD WGEDYKLPNI    240
PERELVVYEM NVRAFTADES SCLDQDIRGT YAGLIEKIPH LLELGINAVE LLPVFEFDEF    300
EFQRRPNPRD HMINTWGYST INFFAPMSRY GSGGGGAVSA SREFKEMVKA LHGAGIEVIL    360
DVVYNHTNEA DDKHPYTTSF RGIDNKVYYM VDLNNKGQLL NFSGCGNTFN CNHPVVMELI    420
IDSLRHWVVE YHIDGFRFDL ASVLCRGTDG SPLGAPPLIR AIAKDATLSR CKIIAEPWDC    480
GGLYLVGSFP NWDRWAEWNG KYRDDLRRFI KGDPGMKGAF ATRVSGSADL YRKNKRKPYH    540
SVNFVIAHDG FTLRDLVSYN FKHNEANGEG GNDGSNDNFS WNCGFEGETD NVDIIALRFR    600
QMKNFHLALM VSQGVPMMLM GDEYGHTRYG NNNSYGHDTA LNNFQWQQLN ARKSDHFRFF    660
SEVIHYRQKH RVFSHENFLD RSDVTWHEDN WDNPDSKFLA FTLHDKGGGE IYLAFNAHDF    720
FVKVSIPPAP PKRRWFRVVD TNLASPDDFV GEGVPGIGST YNVAPYSSIL LEAK*         780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK14510PRK145108.0e-13096730670+
PRK03705PRK037053.0e-15396669596+
cd11326AmyAc_Glg_debranch0229670445+
COG1523PulA089759706+
TIGR02100glgX_debranch096746694+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0043169cation binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAZ81837.10467748735isoamylase isoform 3 [Pisum sativum]
DDBJBAF52943.105577465782isoamylase-type starch-debranching enzyme 3 [Phaseolus vulgaris]
EMBLCBI19205.1017741774unnamed protein product [Vitis vinifera]
RefSeqXP_002284042.10177413786PREDICTED: similar to isoamylase-type starch-debranching enzyme 3 [Vitis vinifera]
RefSeqXP_002513977.1027748781isoamylase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vuy_B09675314699A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase
PDB2vuy_A09675314699A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase
PDB2vr5_B09675314699A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase
PDB2vr5_A09675314699A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase
PDB2vnc_B09675314699A Chain A, Crystal Structure Of Glycogen Debranching Enzyme Trex From Sulfolobus Solfataricus
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7987254551906440
HO7796252435327740
HO7796251903485370
HO4657002502855340
HO798725356596930.0001
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00091.4Aquca_014_00091.1Aquca_014_00091.3Aquca_014_00091.2Aquca_014_00091.5
Aquca_014_00091.6Aquca_014_00091.7Aquca_018_00158.1Aquca_018_00158.2Aquca_014_00091.8
Aquca_026_00010.1
Arabidopsis lyrata911044483030470308
Arabidopsis thalianaAT4G09020.1AT2G39930.1AT1G03310.2AT1G03310.1
Brachypodium distachyonBradi4g32707.2Bradi4g32707.1Bradi3g40410.2Bradi3g40410.1Bradi2g26170.1
Brassica rapaBra000667Bra005001Bra030528Bra033388
Carica papayaevm.model.supercontig_36.185evm.model.supercontig_485.4evm.model.supercontig_115.45
Capsella rubellaCarubv10003443mCarubv10024947mCarubv10012076m
Chlamydomonas reinhardtiig4436.t1g3160.t1
Citrus clementinaCiclev10000452mCiclev10000347mCiclev10007489mCiclev10023436m
Citrus sinensisorange1.1g009902morange1.1g006791morange1.1g003977morange1.1g011993morange1.1g005976m
orange1.1g003653morange1.1g003901morange1.1g005552morange1.1g047308m
Cucumis sativusCucsa.311690.1Cucsa.281840.2Cucsa.281840.1Cucsa.084930.1
Eucalyptus grandisEucgr.B00043.1Eucgr.C02189.3Eucgr.C02189.2Eucgr.C02189.1Eucgr.K03392.1
Fragaria vescamrna11912.1-v1.0-hybridmrna12022.1-v1.0-hybridmrna27855.1-v1.0-hybrid
Glycine maxGlyma06g10540.2Glyma04g10693.3Glyma04g10693.2Glyma04g10693.1Glyma08g03210.2
Glyma08g03210.1Glyma03g30771.1Glyma19g33620.2
Gossypium raimondiiGorai.009G233800.2Gorai.009G233800.3Gorai.012G008800.3Gorai.012G008800.2Gorai.012G008800.1
Gorai.007G134600.3Gorai.007G134600.2Gorai.007G134600.1
Linum usitatissimumLus10036474Lus10021586Lus10000661Lus10027999Lus10017150
Malus domesticaMDP0000119748MDP0000118987MDP0000313388MDP0000185233MDP0000647541
MDP0000258604MDP0000238431
Manihot esculentacassava4.1_001932mcassava4.1_001414m
Medicago truncatulaMedtr3g099500.1Medtr8g101490.1
Mimulus guttatusmgv1a002417mmgv1a001549mmgv1a001869m
Oryza sativaLOC_Os08g40930.1LOC_Os09g29404.3LOC_Os09g29404.1LOC_Os05g32710.1
Panicum virgatumPavirv00034683mPavirv00034682mPavirv00063957mPavirv00032505mPavirv00012813m
Physcomitrella patensPp1s25_63V6.1Pp1s36_254V6.2Pp1s36_254V6.1Pp1s62_201V6.2
Phaseolus vulgarisPhvul.009G033200.1Phvul.002G303600.1Phvul.001G148700.1Phvul.005G040300.1
Picea abiesMA_10431226g0020MA_159157g0180
Populus trichocarpaPotri.002G100900.2Potri.002G100900.4Potri.002G100900.3Potri.002G100900.1Potri.006G070800.3
Potri.006G070800.2Potri.006G070800.1Potri.018G132500.4Potri.018G132500.3Potri.018G132500.2
Potri.018G132500.1Potri.018G132500.5Potri.002G215400.1Potri.002G219900.1
Prunus persicappa001639mppa025097mppa001199m
Ricinus communis29908.m00608929776.m00048828153.m00028728323.m00004135877.m000015
27724.m00001829104.m000024
Setaria italicaSi029005mSi013277m
Selaginella moellendorffii10621875877414611
Sorghum bicolorSb02g027280.3Sb02g027280.2Sb02g027280.1Sb07g027200.1Sb09g019480.1
Thellungiella halophilaThhalv10028487mThhalv10028455mThhalv10028452mThhalv10016275mThhalv10006762m
Vitis viniferaGSVIVT01009087001GSVIVT01035168001GSVIVT01011096001
Volvox carteriVocar20007238mVocar20007651m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)