y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.009G260600.1
FamilyAA1
Protein PropertiesLength: 557 Molecular Weight: 62136.8 Isoelectric Point: 5.8297
ChromosomeChromosome/Scaffold: 09 Start: 21484322 End: 21486961
Descriptionlaccase 14
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA1165360
  AEVHHYEFFVRESNFSKLCNTTTLLVVNDSYPGPEIRVRRGDTVFVNVHNQGNYGFTIHWHGVKQPRNPWFDGPEFITQCPIQPGTNFTYEVILSDEIGT
  LWWHAHSDWTRGSVQGAFIILPAENETYPFPTPDADQTIILQSWYNGDYKQIIDQALATGIPPRQPDAYAINGNLGDTYGCTNDTIFRMQVDYEKMYLLR
  IINAAMNEQQFFAITNHTLTVVAQDASYVQRFTSDYILISPGQTMDVLVSANQNVGQYYMATRPFSDASAMPPDNITTGIFQYTNSDGGLNASLITLPAR
  DDTNATNSFISRIRNTNVTQNPPLNVPTGIDRRVFITIATNTVPCNTSQCLLPNRFVASLNNVSFVFPRIDILQAYYNSTGGVFTEDFPLNPPVFYDFTG
  NLTGFNTRAELGTRAVVLNYGEAVEIVLQATQLGGGGSHPIHLHGFSFYRVGSGSGNFNNETDPSTYNLVDPPLINTIHVPGKGWAALRFFANNPGVWFM
  HCHFERHSSWGMDTVFIVRNG
Full Sequence
Protein Sequence     Length: 557     Download
MVRRVLFLST LFLCSAEVHH YEFFVRESNF SKLCNTTTLL VVNDSYPGPE IRVRRGDTVF    60
VNVHNQGNYG FTIHWHGVKQ PRNPWFDGPE FITQCPIQPG TNFTYEVILS DEIGTLWWHA    120
HSDWTRGSVQ GAFIILPAEN ETYPFPTPDA DQTIILQSWY NGDYKQIIDQ ALATGIPPRQ    180
PDAYAINGNL GDTYGCTNDT IFRMQVDYEK MYLLRIINAA MNEQQFFAIT NHTLTVVAQD    240
ASYVQRFTSD YILISPGQTM DVLVSANQNV GQYYMATRPF SDASAMPPDN ITTGIFQYTN    300
SDGGLNASLI TLPARDDTNA TNSFISRIRN TNVTQNPPLN VPTGIDRRVF ITIATNTVPC    360
NTSQCLLPNR FVASLNNVSF VFPRIDILQA YYNSTGGVFT EDFPLNPPVF YDFTGNLTGF    420
NTRAELGTRA VVLNYGEAVE IVLQATQLGG GGSHPIHLHG FSFYRVGSGS GNFNNETDPS    480
TYNLVDPPLI NTIHVPGKGW AALRFFANNP GVWFMHCHFE RHSSWGMDTV FIVRNGTTTE    540
TSIRPPPSTM PRCPGT*                                                   600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR03390ascorbOXfungal3.0e-4725535546+
PLN02191PLN021911.0e-5815532554+
PLN02604PLN026044.0e-721531568+
TIGR03388ascorbase1.0e-7918531550+
TIGR03389laccase016553540+
Gene Ontology
GO TermDescription
GO:0005507copper ion binding
GO:0016491oxidoreductase activity
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAR83118.10555614566secretory laccase [Gossypium arboreum]
GenBankACI46953.10655316566putative lacasse/diphenol oxidase [Castanea mollissima]
RefSeqXP_002325572.10115538551predicted protein [Populus trichocarpa]
RefSeqXP_002325575.10135538551multicopper oxidase [Populus trichocarpa]
RefSeqXP_002527130.10655315570laccase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1asq_B0165311521A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB1asq_A0165311521A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB1asp_B0165311521A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB1asp_A0165311521A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB1aso_B0165311521A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
Signal Peptide
Cleavage Site
16
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GR92710724252460
EY1977303301624880
EX1670503301624880
CO11274225252560
GR927107262462710.0001
Orthologous Group
SpeciesID
Arabidopsis lyrata917686487747
Arabidopsis thalianaAT5G48100.1AT5G09360.1
Brachypodium distachyonBradi3g59210.1Bradi3g59187.1
Brassica rapaBra020720Bra037510
Capsella rubellaCarubv10027828mCarubv10000589m
Citrus clementinaCiclev10003795m
Citrus sinensisorange1.1g036841m
Cucumis sativusCucsa.345760.1
Eucalyptus grandisEucgr.L01441.1Eucgr.J00889.1Eucgr.F02650.1Eucgr.H04936.1Eucgr.F04163.1
Eucgr.F02674.1Eucgr.H04937.1Eucgr.F02648.1Eucgr.F02642.1Eucgr.F02646.1
Eucgr.L00623.1Eucgr.B01273.1Eucgr.H02579.1Eucgr.F02649.1Eucgr.F04160.1
Eucgr.F04162.1Eucgr.F02641.1Eucgr.F04154.1Eucgr.L01656.1Eucgr.F02644.1
Eucgr.L00621.1Eucgr.C02745.1Eucgr.J00888.1Eucgr.F02652.2Eucgr.F02652.1
Eucgr.L01343.1Eucgr.L02310.1Eucgr.E04216.1Eucgr.G00841.1Eucgr.E04217.1
Eucgr.E04220.1Eucgr.E04219.1Eucgr.E04218.1Eucgr.E04221.1Eucgr.L01345.1
Eucgr.E03935.1Eucgr.F04158.1Eucgr.F02653.1Eucgr.E03932.1Eucgr.F04157.1
Eucgr.F02642.2Eucgr.F02649.2
Fragaria vescamrna16187.1-v1.0-hybridmrna27556.1-v1.0-hybridmrna27557.1-v1.0-hybridmrna27526.1-v1.0-hybridmrna27527.1-v1.0-hybrid
mrna27523.1-v1.0-hybridmrna15091.1-v1.0-hybridmrna27531.1-v1.0-hybridmrna24290.1-v1.0-hybridmrna27522.1-v1.0-hybrid
mrna17621.1-v1.0-hybridmrna11910.1-v1.0-hybridmrna24296.1-v1.0-hybridmrna05430.1-v1.0-hybridmrna24295.1-v1.0-hybrid
mrna02152.1-v1.0-hybridmrna24292.1-v1.0-hybridmrna08067.1-v1.0-hybridmrna11940.1-v1.0-hybrid
Glycine maxGlyma11g36058.1Glyma16g27480.1Glyma10g36320.1Glyma20g31280.1Glyma10g36310.1
Glyma20g31270.1
Gossypium raimondiiGorai.009G260400.1Gorai.009G260400.2Gorai.005G076600.2Gorai.005G076600.1Gorai.005G076600.3
Gorai.009G261300.1Gorai.009G261000.1Gorai.009G260800.1Gorai.010G130100.1Gorai.009G260400.3
Gorai.009G261100.1Gorai.009G261500.1
Linum usitatissimumLus10041067Lus10026812Lus10036070Lus10041066
Malus domesticaMDP0000546342MDP0000143780MDP0000168293MDP0000318606MDP0000262848
MDP0000090732MDP0000242301MDP0000252988MDP0000724206MDP0000419919
MDP0000188477MDP0000263468MDP0000148967
Manihot esculentacassava4.1_028126mcassava4.1_005540mcassava4.1_026478mcassava4.1_027769m
Medicago truncatulaMedtr3g101640.1.30.558Medtr3g101640.1.30.558Medtr2g008330.1
Mimulus guttatusmgv1a018195mmgv1a019066mmgv1a021399mmgv1a003690mmgv1a004060m
Oryza sativaLOC_Os02g51440.1LOC_Os11g47390.1
Panicum virgatumPavirv00068445mPavirv00039877mPavirv00029470mPavirv00044315mPavirv00029948m
Phaseolus vulgarisPhvul.004G086400.1Phvul.007G086400.1Phvul.007G086500.1Phvul.004G087000.1
Populus trichocarpaPotri.005G200600.1Potri.005G200500.1Potri.011G071100.1Potri.019G088900.1Potri.019G088500.1
Potri.019G088600.1Potri.019G088800.1Potri.019G088700.1Potri.019G088700.2Potri.005G200700.1
Potri.001G206200.1Potri.005G200500.2Potri.005G200600.2
Prunus persicappa016123mppa003529mppa003546mppa016865mppa015996m
ppa025323mppa003489mppa014804mppa003580mppa003663m
ppa003583mppa025087m
Ricinus communis28644.m00090929703.m00152429703.m00152729703.m00153128660.m000189
29703.m00153028644.m00094028644.m00093728644.m000938
Setaria italicaSi016752mSi007952mSi019864mSi019724m
Sorghum bicolorSb04g027860.1Sb04g034620.1Sb04g034610.1Sb04g027850.1Sb10g030340.1
Sb05g022480.1
Thellungiella halophilaThhalv10003921mThhalv10015612m
Vitis viniferaGSVIVT01001603001GSVIVT01012329001GSVIVT01013689001GSVIVT01013695001GSVIVT01013694001
GSVIVT01012332001GSVIVT01034783001GSVIVT01012343001GSVIVT01034842001GSVIVT01034817001
GSVIVT01001604001GSVIVT01001614001GSVIVT01012346001GSVIVT01013687001.321.754GSVIVT01013687001.321.754
GSVIVT01012359001GSVIVT01034828001GSVIVT01013692001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)