y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.009G265200.1
FamilyGH35
Protein PropertiesLength: 700 Molecular Weight: 78656.1 Isoelectric Point: 7.5064
ChromosomeChromosome/Scaffold: 09 Start: 21966548 End: 21973692
DescriptionGlycosyl hydrolase family 35 protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH35333370
  LIINGQRKLLFSASIHYPRSTPEMWGSLIGKAKEGGIDVIQTYVFWNLHEPGKGQYDFSGRADIVRFIKEIQAHGLYASLRIGPFIEAEWNYGGLPFWLH
  DVPGIVYRCDNEPFKVHMQNFTTKIVNMMKSENLYASQGGPIILSQIENEYEMVEHAFHEKGPPYVRWAAQMAVALQTGVPWMMCKQYDAPDPVINTCNG
  MKCGVSFPGPNSPNKPWLWTENWTTWYRAYGKEPETRSAQDIAFQVALFVARNGTFVNYYMYHGGTNFGRTTSAFTTTSYYDDAPLDEYGFIRLPKWGHL
  KQLHE
Full Sequence
Protein Sequence     Length: 700     Download
MEKGMLVLGL VAIMVVGVVV VVESSVEGDG RSLIINGQRK LLFSASIHYP RSTPEMWGSL    60
IGKAKEGGID VIQTYVFWNL HEPGKGQYDF SGRADIVRFI KEIQAHGLYA SLRIGPFIEA    120
EWNYGGLPFW LHDVPGIVYR CDNEPFKVHM QNFTTKIVNM MKSENLYASQ GGPIILSQIE    180
NEYEMVEHAF HEKGPPYVRW AAQMAVALQT GVPWMMCKQY DAPDPVINTC NGMKCGVSFP    240
GPNSPNKPWL WTENWTTWYR AYGKEPETRS AQDIAFQVAL FVARNGTFVN YYMYHGGTNF    300
GRTTSAFTTT SYYDDAPLDE YGFIRLPKWG HLKQLHEAIK SCSNPILFGT QFTLSLGQQQ    360
MGYIYQRNSG ECAAFLVNQD DTKSVAVIFH NSSYELGPSS VSILPDCKNV VFNTAKVNVK    420
NNTRLITTGK KFNESEMWQE FKDIIPTFAD TSMRSKTLLE HMNTTKDMSD YLWYTFSYQH    480
ESSNSKAVLS VRSAGHVLHA FVNGASVGSG NGNHEKVNFT LDNTITLNNG SNNISLLSVT    540
VGLPDSGAFL ERKALGLRRV RIHDIQNSKD LSNHRWGYQV GLLGEKLQIY IDHSSSNVQW    600
RNFTSSNNPL TWYKVRFDAP AKNESFGLNL ESMGKGEVWI NGQSIGRYWA SFLTSQGSPY    660
QTWYHVPRSF LKPKDNLLVI LEEQNGSPLG ISLDIISTI*                          720
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG1874LacA3.0e-1629183166+
pfam01301Glyco_hydro_352.0e-14732339322+
PLN03059PLN03059029693698+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004565beta-galactosidase activity
GO:0005975carbohydrate metabolic process
GO:0009341beta-galactosidase complex
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI18991.102969735705unnamed protein product [Vitis vinifera]
RefSeqXP_002274012.102469760735PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002284529.102969727697PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002306647.10256971668predicted protein [Populus trichocarpa]
RefSeqXP_002521778.102969727710beta-galactosidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3d3a_A8.00141e-43233355325A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3d3a_A0.00001589682486572A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_D7e-303232217318A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_C7e-303232217318A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
Transmembrane Domains
StartEnd
726
Signal Peptide
Cleavage Site
24
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO0744932921254160
HO778160698296930
HO780602592766540
HO7955525301166320
HO780602306546831.8
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00260.2Aquca_014_00260.1Aquca_006_00263.3Aquca_006_00263.2Aquca_006_00263.1
Arabidopsis lyrata496568476906491156480556912308
Arabidopsis thalianaAT5G63800.1AT1G77410.1AT4G38590.2AT4G38590.1AT2G16730.1
AT4G35010.1
Brachypodium distachyonBradi2g56597.1Bradi3g42330.1Bradi4g36517.1Bradi2g24670.1
Brassica rapaBra029200Bra011577Bra017687Bra013052Bra001991
Bra033571Bra024237
Carica papayaevm.model.supercontig_37.29evm.model.supercontig_64.121evm.model.supercontig_64.120evm.model.supercontig_37.144
Capsella rubellaCarubv10028665mCarubv10022317mCarubv10007813mCarubv10006573mCarubv10016129m
Citrus clementinaCiclev10000420mCiclev10004034mCiclev10003478mCiclev10023501mCiclev10026929m
Ciclev10030124m
Citrus sinensisorange1.1g003612morange1.1g041957morange1.1g045037morange1.1g035496morange1.1g006326m
orange1.1g006301m
Cucumis sativusCucsa.060550.1Cucsa.370570.1
Eucalyptus grandisEucgr.H05090.1Eucgr.G01775.1Eucgr.I02332.1Eucgr.I01412.1
Fragaria vescamrna24180.1-v1.0-hybridmrna11229.1-v1.0-hybridmrna06055.1-v1.0-hybridmrna07651.1-v1.0-hybrid
Glycine maxGlyma06g16430.1Glyma04g38580.3Glyma08g00470.1Glyma04g38580.1Glyma04g38580.2
Glyma08g00470.2Glyma04g42620.3Glyma06g12150.1Glyma04g42620.2Glyma06g12150.2
Glyma12g03650.1Glyma12g03650.2Glyma04g00520.1Glyma11g11500.1
Gossypium raimondiiGorai.012G037700.1Gorai.010G052200.1Gorai.010G052300.1Gorai.002G197200.3Gorai.002G197200.2
Gorai.002G197200.1Gorai.002G197100.1Gorai.008G036000.1
Linum usitatissimumLus10020875.306.587Lus10020875.306.587Lus10028538Lus10033502Lus10033427
Lus10018138Lus10008259Lus10033500Lus10020875.38.306Lus10020875.38.306
Lus10014126Lus10019784Lus10005071Lus10027844Lus10027843
Malus domesticaMDP0000202466MDP0000316304MDP0000243780MDP0000206284MDP0000322037
MDP0000320504MDP0000225967MDP0000222132MDP0000863563
Manihot esculentacassava4.1_033913mcassava4.1_025630mcassava4.1_023088mcassava4.1_031197mcassava4.1_023181m
cassava4.1_023219m
Medicago truncatulaMedtr3g096910.1Medtr8g095690.1Medtr3g088520.1Medtr3g117840.1Medtr4g073290.1
Mimulus guttatusmgv1a018569mmgv1a001345m
Oryza sativaLOC_Os05g35360.1LOC_Os08g43570.1LOC_Os09g36810.1
Panicum virgatumPavirv00062685mPavirv00037142mPavirv00063105mPavirv00038064mPavirv00037143m
Pavirv00021342mPavirv00010263mPavirv00038026mPavirv00010484m
Phaseolus vulgarisPhvul.009G153000.1Phvul.009G127500.1Phvul.009G119400.1Phvul.L007600.1Phvul.009G119600.1
Phvul.011G035300.1
Picea abiesMA_65469g0020
Populus trichocarpaPotri.005G069200.2Potri.005G069200.1Potri.005G180600.1Potri.002G080700.1Potri.013G105100.1
Potri.009G134400.1Potri.004G174800.1
Prunus persicappa001308mppa019277mppa026900mppa020492m
Ricinus communis29648.m00200830074.m001370
Setaria italicaSi004751mSi021244mSi024535mSi013260mSi028962m
Sorghum bicolorSb09g021140.1Sb07g024870.1Sb02g031260.1
Thellungiella halophilaThhalv10018129mThhalv10005464mThhalv10024392mThhalv10022550m
Vitis viniferaGSVIVT01022353001GSVIVT01008835001GSVIVT01008834001GSVIVT01024031001
Zea maysAC234152.1_FGT005
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)