y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.009G319400.1
FamilyGT2
Protein PropertiesLength: 336 Molecular Weight: 37911.2 Isoelectric Point: 9.0401
ChromosomeChromosome/Scaffold: 09 Start: 30553374 End: 30557158
DescriptionNucleotide-diphospho-sugar transferases superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT2692651.5e-34
  SLIIPAYNEEYRLPGTLNETMNYLQQRAANDKSFSYEVVIVDDGSKDGTKRVAFDFVKKYGVDNVRVILLGKNHGKGEAIRKGMLHSRGELLLMLDADGA
  TKVTDLEKLENQIHAIVRKDYHPGDSAAGEATFRISDIPIVAFGSRAHLEEKALATRKWYRNFLMKGFHLVVLLAAGPGIRDTQCGFKMFTRSAARK
Full Sequence
Protein Sequence     Length: 336     Download
MGVLLTTLEF LASLLLIFLL GFVSVTVLEA YRRRHTNAHV EAPAMFEDPE SLKQVPCPDI    60
VDPAEKYLSL IIPAYNEEYR LPGTLNETMN YLQQRAANDK SFSYEVVIVD DGSKDGTKRV    120
AFDFVKKYGV DNVRVILLGK NHGKGEAIRK GMLHSRGELL LMLDADGATK VTDLEKLENQ    180
IHAIVRKDYH PGDSAAGEAT FRISDIPIVA FGSRAHLEEK ALATRKWYRN FLMKGFHLVV    240
LLAAGPGIRD TQCGFKMFTR SAARKLFTNI RLKRWCFDVE IVFLCKWFGI PMLEISVNWS    300
EIPGSKVNPL SIPNMLWELA LMSVGYRTRI WKINS*                              360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd06442DPM1_like2.0e-2070289220+
pfam00535Glycos_transf_27.0e-2469267199+
cd04179DPM_DPG-synthase_like4.0e-5170285216+
PTZ00260PTZ002603.0e-9340335301+
cd04188DPG_synthase2.0e-10370306237+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_181493.103233532335glycosyl transferase family 2 protein [Arabidopsis thaliana]
RefSeqXP_002283615.103033530336PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002312095.103033530335predicted protein [Populus trichocarpa]
RefSeqXP_002315224.103133531335predicted protein [Populus trichocarpa]
RefSeqXP_002530857.103233332333Dolichyl-phosphate beta-glucosyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3o3p_B0.00026816696189A Chain A, Crystral Structure Of The N-Terminal Subunit Of Human Maltase- Glucoamylase
PDB3o3p_A0.00026816696189A Chain A, Crystral Structure Of The N-Terminal Subunit Of Human Maltase- Glucoamylase
PDB3kia_C0.00026816696189A Chain A, Crystral Structure Of The N-Terminal Subunit Of Human Maltase- Glucoamylase
PDB3kia_A0.00026816696189A Chain A, Crystral Structure Of The N-Terminal Subunit Of Human Maltase- Glucoamylase
PDB3f1y_C0.00026816696189A Chain A, Mannosyl-3-Phosphoglycerate Synthase From Rubrobacter Xylanophilus
Transmembrane Domains
StartEnd
1028
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
ES822435259783360
DV712496304213240
DV704377288213080
DV711028284213040
DV706626281213010
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_011_00165.2Aquca_011_00165.3Aquca_011_00165.4Aquca_011_00165.1
Arabidopsis lyrata482983
Arabidopsis thalianaAT2G39630.2AT2G39630.1
Brachypodium distachyonBradi1g03660.1
Brassica rapaBra005029Bra000139
Carica papayaevm.model.supercontig_1.403
Capsella rubellaCarubv10023563m
Chlamydomonas reinhardtiiCre16.g652850.t1.2
Citrus clementinaCiclev10032053m
Citrus sinensisorange1.1g027065morange1.1g019818morange1.1g023346m
Cucumis sativusCucsa.010820.1Cucsa.165370.1Cucsa.165370.2Cucsa.165370.3
Eucalyptus grandisEucgr.G02933.1Eucgr.G02933.2Eucgr.G02933.3
Fragaria vescamrna26609.1-v1.0-hybrid
Glycine maxGlyma02g10150.1Glyma18g52810.2Glyma18g52810.1Glyma02g10150.3Glyma02g10150.2
Gossypium raimondiiGorai.011G260700.2Gorai.009G319400.2Gorai.009G319400.4Gorai.011G260700.3Gorai.011G260700.1
Gorai.009G319400.3
Linum usitatissimumLus10005164Lus10001691Lus10023414Lus10040296
Malus domesticaMDP0000274007MDP0000272852
Manihot esculentacassava4.1_011328m
Medicago truncatulaMedtr7g026260.2Medtr7g026260.1
Mimulus guttatusmgv1a025143m
Oryza sativaLOC_Os03g60700.1LOC_Os03g60700.2
Panicum virgatumPavirv00060983mPavirv00063183m
Physcomitrella patensPp1s49_46V6.1Pp1s14_205V6.2Pp1s14_205V6.1Pp1s96_201V6.1
Phaseolus vulgarisPhvul.008G010800.1Phvul.008G010800.2
Picea abiesMA_10347707g0010MA_10428813g0010MA_159008g0490MA_158860g0090
Populus trichocarpaPotri.010G204000.4Potri.010G204000.2Potri.010G204000.1Potri.008G055700.1Potri.010G204000.3
Potri.008G055700.2
Prunus persicappa008313m
Ricinus communis30003.m000334
Setaria italicaSi036396m
Selaginella moellendorffii73379414988101926
Sorghum bicolorSb01g003140.1
Thellungiella halophilaThhalv10016901m
Vitis viniferaGSVIVT01016551001
Volvox carteriVocar20012273m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny