Basic Information | |
---|---|
Species | Gossypium raimondii |
Cazyme ID | Gorai.009G360300.1 |
Family | CBM43 |
Protein Properties | Length: 131 Molecular Weight: 14534 Isoelectric Point: 8.483 |
Chromosome | Chromosome/Scaffold: 09 Start: 47403131 End: 47404278 |
Description | Carbohydrate-binding X8 domain superfamily protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 47 | 127 | 2.2e-30 |
WCIAKPSSDQATLLTNVNYACSKVDCQIIQKGCPCFNPDNLINHASIAMNLYYQSMGRNVWNCDFKGSGLIVITDPSYGNC |
Full Sequence |
---|
Protein Sequence Length: 131 Download |
MRYVFLCSLL CFAPLSFRMG KHLSFFLLLF SFISGGTLMK INGQKTWCIA KPSSDQATLL 60 TNVNYACSKV DCQIIQKGCP CFNPDNLINH ASIAMNLYYQ SMGRNVWNCD FKGSGLIVIT 120 DPSYGNCLYA * |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
pfam07983 | X8 | 3.0e-15 | 46 | 115 | 76 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. |
smart00768 | X8 | 3.0e-33 | 46 | 129 | 85 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACJ86001.1 | 0 | 34 | 130 | 17 | 113 | unknown [Medicago truncatula] |
RefSeq | XP_002285661.1 | 0 | 33 | 130 | 17 | 114 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002300444.1 | 0 | 35 | 130 | 21 | 115 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002332529.1 | 0 | 36 | 130 | 26 | 120 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002528491.1 | 0 | 18 | 130 | 3 | 117 | hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 2e-23 | 46 | 127 | 12 | 94 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
CU573702 | 98 | 34 | 131 | 0 |
GW697696 | 98 | 34 | 131 | 0 |
DW505352 | 97 | 33 | 129 | 0 |
BW597143 | 99 | 33 | 131 | 0 |
BW598239 | 99 | 33 | 131 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|
![]() |