y
Basic Information | |
---|---|
Species | Gossypium raimondii |
Cazyme ID | Gorai.009G391300.1 |
Family | CE11 |
Protein Properties | Length: 124 Molecular Weight: 13675.7 Isoelectric Point: 6.753 |
Chromosome | Chromosome/Scaffold: 09 Start: 53123579 End: 53124638 |
Description | UDP-3-O-acyl N-acetylglycosamine deacetylase family protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CE11 | 5 | 94 | 6.4e-30 |
QQTLAGCIELSGKTLQSGKVSKVKIWPGFAGQGRYFEFHSNLIPASIDFVRESLLCTSLCKDGYKIRTVEHLLSALEAKGIDNCRIQIQN |
Full Sequence |
---|
Protein Sequence Length: 124 Download |
IGKLQQTLAG CIELSGKTLQ SGKVSKVKIW PGFAGQGRYF EFHSNLIPAS IDFVRESLLC 60 TSLCKDGYKI RTVEHLLSAL EAKGIDNCRI QIQNLDSEDT EVEVHISCGI DFPKENSLRA 120 YPF* 180 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PRK13188 | PRK13188 | 2.0e-14 | 5 | 92 | 94 | + bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; Reviewed | ||
TIGR00325 | lpxC | 8.0e-20 | 5 | 94 | 95 | + UDP-3-0-acyl N-acetylglucosamine deacetylase. UDP-3-O-(R-3-hydroxymyristoyl)-GlcNAc deacetylase from E. coli , LpxC, was previously designated EnvA. This enzyme is involved in lipid-A precursor biosynthesis. It is essential for cell viability [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]. | ||
pfam03331 | LpxC | 6.0e-21 | 5 | 94 | 95 | + UDP-3-O-acyl N-acetylglycosamine deacetylase. The enzymes in this family catalyze the second step in the biosynthetic pathway for lipid A. | ||
COG0774 | LpxC | 5.0e-21 | 4 | 92 | 95 | + UDP-3-O-acyl-N-acetylglucosamine deacetylase [Cell envelope biogenesis, outer membrane] | ||
PRK13186 | lpxC | 3.0e-25 | 5 | 94 | 94 | + UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase; Reviewed |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0008759 | UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase activity |
GO:0009245 | lipid A biosynthetic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
EMBL | CBI26831.1 | 9.80909e-45 | 1 | 106 | 21 | 126 | unnamed protein product [Vitis vinifera] |
RefSeq | NP_001117351.1 | 9.99995e-41 | 2 | 106 | 36 | 140 | UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Arabidopsis thaliana] |
RefSeq | NP_173874.2 | 8.99999e-40 | 2 | 106 | 36 | 140 | UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Arabidopsis thaliana] |
RefSeq | NP_173884.5 | 2e-39 | 2 | 109 | 79 | 186 | UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Arabidopsis thaliana] |
RefSeq | XP_002281269.1 | 9.80909e-45 | 1 | 106 | 21 | 126 | PREDICTED: hypothetical protein [Vitis vinifera] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 4fw7_D | 0.00000002 | 5 | 92 | 7 | 98 | A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator |
PDB | 4fw7_C | 0.00000002 | 5 | 92 | 7 | 98 | A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator |
PDB | 4fw7_B | 0.00000002 | 5 | 92 | 7 | 98 | A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator |
PDB | 4fw7_A | 0.00000002 | 5 | 92 | 7 | 98 | A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator |
PDB | 4fw6_D | 0.00000002 | 5 | 92 | 7 | 98 | A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
BQ405531 | 105 | 2 | 106 | 0 |
BE053971 | 105 | 2 | 106 | 0 |
CU585894 | 105 | 2 | 106 | 0 |
GW831538 | 108 | 2 | 109 | 0 |
GW932242 | 105 | 2 | 106 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|