| Basic Information | |
|---|---|
| Species | Gossypium raimondii |
| Cazyme ID | Gorai.009G391300.2 |
| Family | CE11 |
| Protein Properties | Length: 121 Molecular Weight: 13253.2 Isoelectric Point: 7.8678 |
| Chromosome | Chromosome/Scaffold: 09 Start: 53123207 End: 53124638 |
| Description | UDP-3-O-acyl N-acetylglycosamine deacetylase family protein |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| CE11 | 5 | 94 | 6.1e-30 |
| QQTLAGCIELSGKTLQSGKVSKVKIWPGFAGQGRYFEFHSNLIPASIDFVRESLLCTSLCKDGYKIRTVEHLLSALEAKGIDNCRIQIQN | |||
| Full Sequence |
|---|
| Protein Sequence Length: 121 Download |
| IGKLQQTLAG CIELSGKTLQ SGKVSKVKIW PGFAGQGRYF EFHSNLIPAS IDFVRESLLC 60 TSLCKDGYKI RTVEHLLSAL EAKGIDNCRI QIQNLDSEDT EVEVHISCGI DFPKGNRKTV 120 * |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PRK13188 | PRK13188 | 2.0e-14 | 5 | 92 | 94 | + bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; Reviewed | ||
| TIGR00325 | lpxC | 6.0e-20 | 5 | 94 | 95 | + UDP-3-0-acyl N-acetylglucosamine deacetylase. UDP-3-O-(R-3-hydroxymyristoyl)-GlcNAc deacetylase from E. coli , LpxC, was previously designated EnvA. This enzyme is involved in lipid-A precursor biosynthesis. It is essential for cell viability [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]. | ||
| pfam03331 | LpxC | 7.0e-21 | 5 | 94 | 95 | + UDP-3-O-acyl N-acetylglycosamine deacetylase. The enzymes in this family catalyze the second step in the biosynthetic pathway for lipid A. | ||
| COG0774 | LpxC | 4.0e-21 | 4 | 92 | 95 | + UDP-3-O-acyl-N-acetylglucosamine deacetylase [Cell envelope biogenesis, outer membrane] | ||
| PRK13186 | lpxC | 3.0e-25 | 5 | 94 | 94 | + UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase; Reviewed | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0008759 | UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase activity |
| GO:0009245 | lipid A biosynthetic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| EMBL | CBI26831.1 | 8.40779e-45 | 1 | 106 | 21 | 126 | unnamed protein product [Vitis vinifera] |
| RefSeq | NP_001117351.1 | 7.00005e-41 | 2 | 106 | 36 | 140 | UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Arabidopsis thaliana] |
| RefSeq | NP_173874.2 | 6e-40 | 2 | 106 | 36 | 140 | UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Arabidopsis thaliana] |
| RefSeq | NP_173884.5 | 8.99999e-40 | 2 | 109 | 79 | 186 | UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Arabidopsis thaliana] |
| RefSeq | XP_002281269.1 | 8.40779e-45 | 1 | 106 | 21 | 126 | PREDICTED: hypothetical protein [Vitis vinifera] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 4fw7_D | 0.00000003 | 5 | 92 | 7 | 98 | A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator |
| PDB | 4fw7_C | 0.00000003 | 5 | 92 | 7 | 98 | A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator |
| PDB | 4fw7_B | 0.00000003 | 5 | 92 | 7 | 98 | A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator |
| PDB | 4fw7_A | 0.00000003 | 5 | 92 | 7 | 98 | A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator |
| PDB | 4fw6_D | 0.00000003 | 5 | 92 | 7 | 98 | A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| BQ405531 | 105 | 2 | 106 | 0 |
| BE053971 | 105 | 2 | 106 | 0 |
| CU585894 | 105 | 2 | 106 | 0 |
| GW831538 | 108 | 2 | 109 | 0 |
| GW932242 | 105 | 2 | 106 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |