y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.009G406400.6
FamilyGH13
Protein PropertiesLength: 528 Molecular Weight: 60916 Isoelectric Point: 5.941
ChromosomeChromosome/Scaffold: 09 Start: 59764025 End: 59775348
Descriptionstarch branching enzyme 2.2
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH13243451.9e-30
  LPRIKRLGYNAVQIMAIQEHSYYASFGYHVTNFFAPSSRFGTPDDLKSLIDRAHELGLLVLMDIVHSHASNNVLDGLNMFDGTDAHYFHSGSKGHHWMWD
  SRLFNYGSWEVLRFLLSNARWWLEEYKFDGFRFDGVTSMMYTHHGLQVAFTGNYNEYFGYATDVEAVVYLMLVNDMIHGLYPEAVTIGEDVSGMPTFCLP
  VQDGGVGFDYRLHMAVADKWIELLKKRDEDWKMGDIVYTLVNRRWLEKCVVYAESHDQALVGDKTIAFWLMDKDMYDFMSLDRPSSPIIDRGIALHKMIR
  LITMGLGGEGYLNFMGNEFGHP
Full Sequence
Protein Sequence     Length: 528     Download
MLPQNAVVVE PLINTYANFR DNVLPRIKRL GYNAVQIMAI QEHSYYASFG YHVTNFFAPS    60
SRFGTPDDLK SLIDRAHELG LLVLMDIVHS HASNNVLDGL NMFDGTDAHY FHSGSKGHHW    120
MWDSRLFNYG SWEVLRFLLS NARWWLEEYK FDGFRFDGVT SMMYTHHGLQ VAFTGNYNEY    180
FGYATDVEAV VYLMLVNDMI HGLYPEAVTI GEDVSGMPTF CLPVQDGGVG FDYRLHMAVA    240
DKWIELLKKR DEDWKMGDIV YTLVNRRWLE KCVVYAESHD QALVGDKTIA FWLMDKDMYD    300
FMSLDRPSSP IIDRGIALHK MIRLITMGLG GEGYLNFMGN EFGHPEWIDF PRGEQHLPSG    360
KVIPGNNFSY DKCRRRFDLG DADYLRYKGM QQFDQAMQHV EAKYGFMTSE HQYISRKDEG    420
ERVIVFERGN LVFVFNFHWH ESYGGYRVGC SKPGKYKIVL DSDDLLFGGF NRLNHDVEFF    480
STEGWYDNRP RSLLVYAPNR TAVVYALVED EPKATGNLQL TENVKNC*                 540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG0296GlgB9.0e-9315507500+
PLN03244PLN032447.0e-12241507479+
PLN02960PLN029602.0e-16310508502+
PLN02447PLN02447010511503+
cd11321AmyAc_bac_euk_BE010395387+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0005975carbohydrate metabolic process
GO:0043169cation binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAT76444.1010511331832starch branching enzyme II [Vigna radiata]
GenBankABN05322.109511325827starch branching enzyme II [Populus trichocarpa]
DDBJBAA82348.2010512346849starch branching enzyme [Phaseolus vulgaris]
EMBLCAA56319.1010526347861starch branching enzyme I [Pisum sativum]
RefSeqXP_002534111.109526338852starch branching enzyme II, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3amk_A010511194696A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L
PDB3vu2_B010511194696A Chain A, Structure Of The Starch Branching Enzyme I (bei) Complexed With Maltopentaose From Oryza Sativa L
PDB3vu2_A010511194696A Chain A, Structure Of The Starch Branching Enzyme I (bei) Complexed With Maltopentaose From Oryza Sativa L
PDB3aml_A010511194696A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L
PDB1m7x_D2e-3915474153582A Chain A, The X-Ray Crystallographic Structure Of Branching Enzyme
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO777638504105120
HO794536504105120
HO4581233951145080
HO45812310591130
HO619167524105220
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_066_00053.1Aquca_027_00415.5Aquca_027_00415.4Aquca_027_00415.3Aquca_027_00415.2
Aquca_027_00415.1Aquca_015_00400.6Aquca_015_00400.5Aquca_015_00400.2Aquca_015_00400.1
Aquca_015_00400.3Aquca_015_00400.4
Arabidopsis lyrata873536321348908239
Arabidopsis thalianaAT3G20440.3AT3G20440.2AT2G36390.1AT5G03650.1
Brachypodium distachyonBradi1g41970.2Bradi1g41970.1Bradi1g29850.2Bradi1g29850.1Bradi5g09170.2
Bradi5g09170.1Bradi3g44760.1
Brassica rapaBra035782Bra005269Bra017241Bra009521
Carica papayaevm.model.supercontig_5.62
Capsella rubellaCarubv10012936mCarubv10022617mCarubv10000235m
Chlamydomonas reinhardtiiCre06.g270100.t1.3Cre10.g444700.t1.1Cre06.g289850.t1.3Cre08.g373450.t1.1
Citrus clementinaCiclev10007401mCiclev10011063mCiclev10000406mCiclev10000374mCiclev10000272m
Ciclev10000256m
Citrus sinensisorange1.1g035501morange1.1g002609morange1.1g004765morange1.1g004253morange1.1g003474m
orange1.1g003390morange1.1g003230morange1.1g003226m
Cucumis sativusCucsa.378410.2Cucsa.378410.1Cucsa.077550.3Cucsa.077550.1Cucsa.077550.2
Eucalyptus grandisEucgr.F03487.1Eucgr.A01533.1Eucgr.F01770.1
Fragaria vescamrna30233.1-v1.0-hybridmrna08644.1-v1.0-hybridmrna08646.1-v1.0-hybrid
Glycine maxGlyma18g10385.1Glyma03g35020.2Glyma03g35020.1Glyma19g37750.2Glyma19g37750.1
Glyma04g01950.2
Gossypium raimondiiGorai.009G406400.4Gorai.011G196000.5Gorai.011G196000.4Gorai.011G196000.3Gorai.011G196000.2
Gorai.011G196000.12Gorai.011G196000.1Gorai.011G196000.7Gorai.011G196000.6Gorai.011G196000.13
Gorai.002G172100.7Gorai.002G172100.5Gorai.002G172100.3Gorai.002G172100.2Gorai.002G172100.1
Gorai.009G441800.2Gorai.009G441800.1Gorai.009G406400.5Gorai.009G406400.3Gorai.009G406400.2
Gorai.009G406400.1Gorai.002G241400.7Gorai.002G241400.6Gorai.002G241400.5Gorai.002G241400.4
Gorai.002G241400.2Gorai.002G241400.1Gorai.005G113800.3Gorai.005G113800.2Gorai.005G113800.1
Linum usitatissimumLus10000912Lus10023878Lus10014382Lus10016012Lus10012264
Malus domesticaMDP0000218396MDP0000148418MDP0000214735MDP0000177786
Manihot esculentacassava4.1_006199mcassava4.1_004366mcassava4.1_003773mcassava4.1_001701mcassava4.1_001686m
cassava4.1_002337mcassava4.1_002172mcassava4.1_002171mcassava4.1_001826mcassava4.1_001598m
cassava4.1_001595m
Medicago truncatulaMedtr7g104080.1
Mimulus guttatusmgv1a001162mmgv1a001301mmgv1a001932m
Oryza sativaLOC_Os02g32660.2LOC_Os06g26234.3LOC_Os06g26234.2LOC_Os06g26234.1LOC_Os02g32660.1
LOC_Os06g51084.8LOC_Os06g51084.7LOC_Os06g51084.6LOC_Os06g51084.5LOC_Os06g51084.4
LOC_Os06g51084.3LOC_Os06g51084.2LOC_Os06g51084.1
Panicum virgatumPavirv00035568mPavirv00058932mPavirv00002278mPavirv00067040mPavirv00061484m
Pavirv00061483mPavirv00061485m
Physcomitrella patensPp1s200_23V6.1Pp1s15_181V6.2Pp1s15_181V6.1Pp1s54_189V6.2Pp1s54_189V6.1
Pp1s64_78V6.1
Phaseolus vulgarisPhvul.006G047000.1Phvul.001G187600.1Phvul.009G011000.1
Picea abiesMA_10430611g0010
Populus trichocarpaPotri.006G115100.5Potri.001G359200.1Potri.006G115100.6Potri.006G115100.4Potri.006G115100.3
Potri.006G115100.2Potri.006G115100.1Potri.005G251000.5Potri.005G251000.4Potri.005G251000.3
Potri.005G251000.2Potri.005G251000.1Potri.005G251000.6
Prunus persicappa016544mppa001312mppa001929m
Ricinus communis29762.m00048630170.m01435927496.m000095
Setaria italicaSi008087mSi016350mSi009379mSi009312mSi005911m
Si006006mSi006081m
Selaginella moellendorffii165481437348437417
Sorghum bicolorSb03g027310.1Sb04g021540.1Sb06g015360.1Sb10g030776.1
Thellungiella halophilaThhalv10020019mThhalv10016249mThhalv10012785mThhalv10012784mThhalv10012679m
Vitis viniferaGSVIVT01037695001GSVIVT01033801001GSVIVT01008673001
Volvox carteriVocar20012173mVocar20015251mVocar20002436mVocar20007338m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)