Basic Information | |
---|---|
Species | Gossypium raimondii |
Cazyme ID | Gorai.009G429200.2 |
Family | AA6 |
Protein Properties | Length: 153 Molecular Weight: 15918.1 Isoelectric Point: 7.7629 |
Chromosome | Chromosome/Scaffold: 09 Start: 67382265 End: 67383286 |
Description | Quinone reductase family protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
AA6 | 2 | 147 | 0 |
SAPPKSDVPVITPNDLAEADGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQQLAGKPAGIFYSTGSQGGGQETTALTAITQLVHHGMIFVPIGYTFGAGM FEMEQVKGGSPYGAGTYAGDGSRMPSELELAQAFHQGKYIGGITKK |
Full Sequence |
---|
Protein Sequence Length: 153 Download |
MSAPPKSDVP VITPNDLAEA DGFVFGFPTR FGMMSAQFKA FLDATGGLWR TQQLAGKPAG 60 IFYSTGSQGG GQETTALTAI TQLVHHGMIF VPIGYTFGAG MFEMEQVKGG SPYGAGTYAG 120 DGSRMPSELE LAQAFHQGKY IGGITKKLKA AA* |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
COG0431 | COG0431 | 0.008 | 17 | 62 | 46 | + Predicted flavoprotein [General function prediction only] |
pfam03358 | FMN_red | 1.0e-11 | 17 | 95 | 80 | + NADPH-dependent FMN reductase. |
COG0655 | WrbA | 4.0e-27 | 17 | 150 | 135 | + Multimeric flavodoxin WrbA [General function prediction only] |
TIGR01755 | flav_wrbA | 9.0e-41 | 9 | 148 | 141 | + NAD(P)H:quinone oxidoreductase, type IV. This model represents a protein, WrbA, related to and slightly larger than flavodoxin. It was just shown, in E. coli and Archaeoglobus fulgidus (and previously for some eukaryotic homologs) to act as fourth type of NAD(P)H:quinone oxidoreductase. In E. coli, this protein was earlier reported to be produced during stationary phase, bind to the trp repressor, and make trp operon repression more efficient. WrbA does not interact with the trp operator by itself. Members are found in species in which homologs of the E. coli trp operon repressor TrpR are not detected [Energy metabolism, Electron transport]. |
PRK03767 | PRK03767 | 5.0e-50 | 10 | 150 | 142 | + NAD(P)H:quinone oxidoreductase; Provisional |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0009055 | electron carrier activity |
GO:0016491 | oxidoreductase activity |
GO:0050662 | coenzyme binding |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABN12320.1 | 0 | 1 | 152 | 52 | 203 | benzoquinone reductase [Gossypium hirsutum] |
GenBank | ABN12321.1 | 0 | 1 | 152 | 52 | 203 | benzoquinone reductase [Gossypium hirsutum] |
GenBank | ACJ11729.1 | 0 | 1 | 152 | 52 | 203 | benzoquinone reductase [Gossypium hirsutum] |
GenBank | ACU13985.1 | 0 | 1 | 152 | 52 | 203 | unknown [Glycine max] |
RefSeq | XP_002534445.1 | 0 | 1 | 152 | 52 | 203 | Minor allergen Alt a, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 4dy4_C | 9.94922e-44 | 10 | 149 | 58 | 196 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
PDB | 4dy4_A | 9.94922e-44 | 10 | 149 | 58 | 196 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
PDB | 3b6m_B | 9.94922e-44 | 10 | 149 | 59 | 197 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
PDB | 3b6m_A | 9.94922e-44 | 10 | 149 | 59 | 197 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
PDB | 3b6k_B | 9.94922e-44 | 10 | 149 | 59 | 197 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
GR709001 | 153 | 1 | 153 | 0 |
BQ403554 | 153 | 1 | 153 | 0 |
HO090128 | 152 | 1 | 152 | 0 |
ES849598 | 153 | 1 | 153 | 0 |
DW481092 | 153 | 1 | 153 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|