y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.010G052200.1
FamilyGH35
Protein PropertiesLength: 819 Molecular Weight: 91818.6 Isoelectric Point: 8.5833
ChromosomeChromosome/Scaffold: 10 Start: 6009651 End: 6014775
Descriptionbeta-galactosidase 16
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH35333370
  LIIDGQHKILFSGSIHYPRSTPQMWPSLIAKAKAGGLDVIETLVFWNLHEPQPEQFDFSGQRDIVRFIKEIQAQGLYACIRIGPFIQGEWSYGGLPFWLH
  DIPGIVYRSDNEPFKYQMKKFVSKIVNMMKAEKLYASQGGPIILSQIENEYGMVEAAFRDKGPPYLRWAAEMAVGLQTGVPWVMCKQNNAPDPVINACNG
  RRCGETFPGPNSPNKPAIWTENWTSFYQVYGDEPDIRSAEDIAFHVALFIAKKGSYVNYYMYHGGTNFGRTAAAYVLTSYYDQAPLDEYGLFRQPKWGHL
  KELHA
Full Sequence
Protein Sequence     Length: 819     Download
MGSWLFLFLV GLFLAASVSG VGSRNVTYDG RSLIIDGQHK ILFSGSIHYP RSTPQMWPSL    60
IAKAKAGGLD VIETLVFWNL HEPQPEQFDF SGQRDIVRFI KEIQAQGLYA CIRIGPFIQG    120
EWSYGGLPFW LHDIPGIVYR SDNEPFKYQM KKFVSKIVNM MKAEKLYASQ GGPIILSQIE    180
NEYGMVEAAF RDKGPPYLRW AAEMAVGLQT GVPWVMCKQN NAPDPVINAC NGRRCGETFP    240
GPNSPNKPAI WTENWTSFYQ VYGDEPDIRS AEDIAFHVAL FIAKKGSYVN YYMYHGGTNF    300
GRTAAAYVLT SYYDQAPLDE YGLFRQPKWG HLKELHAAIK LCLNPMLSGV YTTMALGKSQ    360
EAFVYRGNSV DCAAFLVNND TRKTVVVTFQ DSLYEMPPKS ISILPDCKTV AFNTAKVSTQ    420
YNTRAVETSK KLDSIVKWEE YKETIPTFED TSLRANMLLE HMNTTKDNSD YLWYNFRFQN    480
DFSDAEYVLN VTSSAHVLHA FVNGSFVGST HGSFKTKTPI LESKITLNKG TNYISLLSGM    540
AGLPDSGAYL ERRVAGINTV RVKGEHEIKD FTRYSWGYQV GLLGEKLQVY TDSGSNKVKW    600
NTYGSSTHQR LTWYRTLFDA PAGKDPVTLN LESMGKGEAW INGQSIGRYW VSFLTPKGIP    660
SQTRYNVPRS FLKRTDNLLV ILEEENGYPL GISIDTISIT KVCGHVSESH LPPVISWQGQ    720
NKTEHNNSKK HHGRRPKVQL QCPPGRNISR ILFASYGNPT GDCENYAIGS CHSFTSLPTI    780
EEACMGKRIC TIPVWRKKFG NDPCPGIPKT LLVDAQCT*                           840
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam13364BetaGal_dom4_55.0e-546150949+
pfam02140Gal_Lectin4.0e-2074081781+
COG1874LacA2.0e-2026301317+
pfam01301Glyco_hydro_351.0e-14832339322+
PLN03059PLN03059022818831+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004565beta-galactosidase activity
GO:0005529Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates." [CHEBI:16646, GOC:mah]
GO:0005975carbohydrate metabolic process
GO:0009341beta-galactosidase complex
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI18990.1018185817unnamed protein product [Vitis vinifera]
EMBLCBI18991.102781733820unnamed protein product [Vitis vinifera]
RefSeqXP_002284529.102781725812PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002302225.10228184798predicted protein [Populus trichocarpa]
RefSeqXP_002306647.10258181764predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3d3a_A1e-393232214313A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3d3a_A0.00006476683387572A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_D8e-312632211318A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_C8e-312632211318A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
Signal Peptide
Cleavage Site
20
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO778160707256990
HO780602592766550
HO7955525301166330
HO7955525325770
HO79555242751160
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00260.2Aquca_014_00260.1Aquca_006_00263.3Aquca_006_00263.2Aquca_006_00263.1
Arabidopsis lyrata496568476906491156480556912308
Arabidopsis thalianaAT5G63800.1AT1G77410.1AT4G38590.2AT4G38590.1AT2G16730.1
AT4G35010.1
Brachypodium distachyonBradi2g56597.1Bradi3g42330.1Bradi4g36517.1Bradi2g24670.1
Brassica rapaBra029200Bra011577Bra017687Bra013052Bra001991
Bra033571Bra024237
Carica papayaevm.model.supercontig_37.29evm.model.supercontig_64.121evm.model.supercontig_64.120evm.model.supercontig_37.144
Capsella rubellaCarubv10028665mCarubv10022317mCarubv10007813mCarubv10006573mCarubv10016129m
Citrus clementinaCiclev10000420mCiclev10004034mCiclev10003478mCiclev10023501mCiclev10026929m
Ciclev10030124m
Citrus sinensisorange1.1g003612morange1.1g041957morange1.1g045037morange1.1g035496morange1.1g006326m
orange1.1g006301m
Cucumis sativusCucsa.060550.1Cucsa.370570.1
Eucalyptus grandisEucgr.H05090.1Eucgr.G01775.1Eucgr.I02332.1Eucgr.I01412.1
Fragaria vescamrna24180.1-v1.0-hybridmrna11229.1-v1.0-hybridmrna06055.1-v1.0-hybridmrna07651.1-v1.0-hybrid
Glycine maxGlyma06g16430.1Glyma04g38580.3Glyma08g00470.1Glyma04g38580.1Glyma04g38580.2
Glyma08g00470.2Glyma04g42620.3Glyma06g12150.1Glyma04g42620.2Glyma06g12150.2
Glyma12g03650.1Glyma12g03650.2Glyma04g00520.1Glyma11g11500.1
Gossypium raimondiiGorai.012G037700.1Gorai.010G052300.1Gorai.009G265200.1Gorai.002G197200.3Gorai.002G197200.2
Gorai.002G197200.1Gorai.002G197100.1Gorai.008G036000.1
Linum usitatissimumLus10020875.306.587Lus10020875.306.587Lus10028538Lus10033502Lus10033427
Lus10018138Lus10008259Lus10033500Lus10020875.38.306Lus10020875.38.306
Lus10014126Lus10019784Lus10005071Lus10027844Lus10027843
Malus domesticaMDP0000202466MDP0000316304MDP0000243780MDP0000206284MDP0000322037
MDP0000320504MDP0000225967MDP0000222132MDP0000863563
Manihot esculentacassava4.1_033913mcassava4.1_025630mcassava4.1_023088mcassava4.1_031197mcassava4.1_023181m
cassava4.1_023219m
Medicago truncatulaMedtr3g096910.1Medtr8g095690.1Medtr3g088520.1Medtr3g117840.1Medtr4g073290.1
Mimulus guttatusmgv1a018569mmgv1a001345m
Oryza sativaLOC_Os05g35360.1LOC_Os08g43570.1LOC_Os09g36810.1
Panicum virgatumPavirv00062685mPavirv00037142mPavirv00063105mPavirv00038064mPavirv00037143m
Pavirv00021342mPavirv00010263mPavirv00038026mPavirv00010484m
Phaseolus vulgarisPhvul.009G153000.1Phvul.009G127500.1Phvul.009G119400.1Phvul.L007600.1Phvul.009G119600.1
Phvul.011G035300.1
Picea abiesMA_65469g0020
Populus trichocarpaPotri.005G069200.2Potri.005G069200.1Potri.005G180600.1Potri.002G080700.1Potri.013G105100.1
Potri.009G134400.1Potri.004G174800.1
Prunus persicappa001308mppa019277mppa026900mppa020492m
Ricinus communis29648.m00200830074.m001370
Setaria italicaSi004751mSi021244mSi024535mSi013260mSi028962m
Sorghum bicolorSb09g021140.1Sb07g024870.1Sb02g031260.1
Thellungiella halophilaThhalv10018129mThhalv10005464mThhalv10024392mThhalv10022550m
Vitis viniferaGSVIVT01022353001GSVIVT01008835001GSVIVT01008834001GSVIVT01024031001
Zea maysAC234152.1_FGT005
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)