y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.010G075800.1
FamilyGT66
Protein PropertiesLength: 789 Molecular Weight: 87465.5 Isoelectric Point: 9.3445
ChromosomeChromosome/Scaffold: 10 Start: 10820208 End: 10828667
Descriptionstaurosporin and temperature sensitive 3-like A
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT66297290
  SFFILLLIGVMAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLAKNGIYEFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTIWWLLNSLNIPLSVETVCVF
  TAPIFSAFASWATYLLTKEVKGTGAGLTAAALLAMVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYATLNSIAYFYMVCSWGGYTFIINL
  IPMHVLLCIVTGRFSSRLYIAYAPLVVLGTLLAALVPVVGFNAVMTSEHFASFLVFIIIHVVAFVYYIKGILSPKMFKVAVTLVVSVGLAVCCAVIAVLI
  ALVASSPTKGWSGRSLSLLDPTYASKYIPIIASVSEHQPPTWPSYFMDINVLAFLVPAGIIACFLPLSDASSFVVLYIATSVYFSGVMVRLMLVLAPAAC
  ITSGIALSQAFDVFTGSIKFQLTGASSNTEVDAAETSSSTAESQTDAVKTEKPEETAKNRPSRKSKKKEREHGEKPSTEAKAEKKRLLALPLESSVISLL
  LLVLLGAFYVVHCVWAAAEAYSAPSIVLTSRSHDGLHVFDDFREAYAWLRHNTDVDDKVASWWDYGYQTTAMANRTVIVDNNTWNNTHIATVGTAMSSPE
  RAAWEIFHSLDVKYVLVVFGGLVGYPSDDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNCLMYKLSYYRFVETDGKGFDRVRQTEIGKK
  Y
Full Sequence
Protein Sequence     Length: 789     Download
MAAPETSTAA VPTLYTNNTL RNAFGGVLSF FILLLIGVMA FSIRLFSVIK YESVIHEFDP    60
YFNYRVTQFL AKNGIYEFWN WFDDRTWYPL GRVIGGTVYP GLTLTAGTIW WLLNSLNIPL    120
SVETVCVFTA PIFSAFASWA TYLLTKEVKG TGAGLTAAAL LAMVPSYISR SVAGSYDNEA    180
VAIFALIFTF YLYIKTLNTG SLFYATLNSI AYFYMVCSWG GYTFIINLIP MHVLLCIVTG    240
RFSSRLYIAY APLVVLGTLL AALVPVVGFN AVMTSEHFAS FLVFIIIHVV AFVYYIKGIL    300
SPKMFKVAVT LVVSVGLAVC CAVIAVLIAL VASSPTKGWS GRSLSLLDPT YASKYIPIIA    360
SVSEHQPPTW PSYFMDINVL AFLVPAGIIA CFLPLSDASS FVVLYIATSV YFSGVMVRLM    420
LVLAPAACIT SGIALSQAFD VFTGSIKFQL TGASSNTEVD AAETSSSTAE SQTDAVKTEK    480
PEETAKNRPS RKSKKKEREH GEKPSTEAKA EKKRLLALPL ESSVISLLLL VLLGAFYVVH    540
CVWAAAEAYS APSIVLTSRS HDGLHVFDDF REAYAWLRHN TDVDDKVASW WDYGYQTTAM    600
ANRTVIVDNN TWNNTHIATV GTAMSSPERA AWEIFHSLDV KYVLVVFGGL VGYPSDDINK    660
FLWMVRIGGG VFPHIKEPDY LRDGQYRIDS QATPTMLNCL MYKLSYYRFV ETDGKGFDRV    720
RQTEIGKKYF KLTHFEEAFT THHWMVRIYK LKPPKNRIRG KTKKSKSKTS STTSSPKRSG    780
 TKKKNPWQ*                                                           840
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG1287COG12873.0e-10563759222+
TIGR04154archaeo_STT33.0e-1132235230+
pfam02516STT36.0e-29535711186+
COG1287COG12872.0e-4228441432+
pfam02516STT39.0e-7427441433+
Gene Ontology
GO TermDescription
GO:0004576oligosaccharyl transferase activity
GO:0006486protein glycosylation
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEEC79544.10237883511119hypothetical protein OsI_20658 [Oryza sativa Indica Group]
RefSeqNP_001056068.1017881787Os05g0519900 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002280521.105078842778PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002325019.105076645759predicted protein [Populus trichocarpa]
RefSeqXP_002514244.105078843779oligosaccharyl transferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2lgz_A054077920263A Chain A, Solution Structure Of Stt3p
PDB3vu0_C0.000045696856123A Chain A, Crystal Structure Of The C-terminal Globular Domain Of Oligosaccharyltransferase (afaglb-s2, Af_0040, O30195_arcfu) From Archaeoglobus Fulgidus
PDB3vu0_B0.000045696856123A Chain A, Crystal Structure Of The C-terminal Globular Domain Of Oligosaccharyltransferase (afaglb-s2, Af_0040, O30195_arcfu) From Archaeoglobus Fulgidus
PDB3vu0_A0.000045696856123A Chain A, Crystal Structure Of The C-terminal Globular Domain Of Oligosaccharyltransferase (afaglb-s2, Af_0040, O30195_arcfu) From Archaeoglobus Fulgidus
Transmembrane Domains
StartEnd
2446
91113
120142
152174
181203
218240
247269
279296
309331
373395
400422
524546
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7788675332287600
HO4763975492187570
HO7969143604017600
HO7788671161152305e-32
HO796914203944139.5
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01458.1Aquca_001_00320.1
Arabidopsis lyrata891007488863
Arabidopsis thalianaAT1G34130.1AT5G19690.1
Brachypodium distachyonBradi5g26030.1Bradi2g49640.1Bradi2g19510.1
Brassica rapaBra028034Bra006514Bra002255Bra034441
Carica papayaevm.model.supercontig_467.1.248.439evm.model.supercontig_467.1.248.439evm.model.supercontig_40.47
Capsella rubellaCarubv10008402mCarubv10000271m
Chlamydomonas reinhardtiiCre07.g330100.t1.2g9581.t1
Citrus clementinaCiclev10019005mCiclev10019106mCiclev10007574mCiclev10007513mCiclev10007684m
Citrus sinensisorange1.1g004635morange1.1g005395morange1.1g004678morange1.1g003973m
Cucumis sativusCucsa.122250.1Cucsa.122250.2Cucsa.329260.1Cucsa.329260.2
Eucalyptus grandisEucgr.K02314.1Eucgr.C01008.1
Fragaria vescamrna09173.1-v1.0-hybridmrna11885.1-v1.0-hybrid
Glycine maxGlyma16g33881.1Glyma09g29470.1Glyma01g01270.1Glyma16g08410.1
Gossypium raimondiiGorai.013G004300.1Gorai.013G004300.2Gorai.011G219600.1Gorai.011G219600.4Gorai.011G219600.3
Gorai.011G219600.2Gorai.011G219600.5Gorai.013G229700.1Gorai.010G075800.2Gorai.010G075800.3
Linum usitatissimumLus10041985Lus10017990Lus10043241Lus10011124
Malus domesticaMDP0000299027MDP0000589608MDP0000158858MDP0000201702MDP0000300736
Manihot esculentacassava4.1_002347mcassava4.1_021540m
Medicago truncatulaMedtr6g077750.1Medtr6g077750.2Medtr1g114250.1
Mimulus guttatusmgv1a001976mmgv1a001650m
Oryza sativaLOC_Os04g57890.1LOC_Os05g44360.1LOC_Os05g44360.2
Panicum virgatumPavirv00017930mPavirv00007453mPavirv00022940mPavirv00024588mPavirv00056880m
Pavirv00065583m
Physcomitrella patensPp1s98_21V6.1Pp1s404_37V6.1Pp1s404_38V6.1
Phaseolus vulgarisPhvul.004G139400.1Phvul.004G170000.1
Picea abiesMA_174842g0010MA_10216317g0010MA_5501292g0010MA_10436134g0010
Populus trichocarpaPotri.012G036300.1Potri.015G028300.1Potri.015G028300.2Potri.018G086000.2Potri.018G086000.1
Potri.006G163600.1
Prunus persicappa001886mppa001464m
Ricinus communis30189.m00167429912.m005461
Setaria italicaSi021341mSi000402mSi021271mSi021321m
Selaginella moellendorffii110405118919
Sorghum bicolorSb06g032800.1Sb09g025920.1Sb03g034385.1
Thellungiella halophilaThhalv10006908mThhalv10012742m
Vitis viniferaGSVIVT01015322001GSVIVT01029339001
Volvox carteriVocar20013212mVocar20003562m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)