y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.010G075800.3
FamilyGT66
Protein PropertiesLength: 575 Molecular Weight: 63638.9 Isoelectric Point: 9.578
ChromosomeChromosome/Scaffold: 10 Start: 10820244 End: 10826735
Descriptionstaurosporin and temperature sensitive 3-like A
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT6615150
  MVCSWGGYTFIINLIPMHVLLCIVTGRFSSRLYIAYAPLVVLGTLLAALVPVVGFNAVMTSEHFASFLVFIIIHVVAFVYYIKGILSPKMFKVAVTLVVS
  VGLAVCCAVIAVLIALVASSPTKGWSGRSLSLLDPTYASKYIPIIASVSEHQPPTWPSYFMDINVLAFLVPAGIIACFLPLSDASSFVVLYIATSVYFSG
  VMVRLMLVLAPAACITSGIALSQAFDVFTGSIKFQLTGASSNTEVDAAETSSSTAESQTDAVKTEKPEETAKNRPSRKSKKKEREHGEKPSTEAKAEKKR
  LLALPLESSVISLLLLVLLGAFYVVHCVWAAAEAYSAPSIVLTSRSHDGLHVFDDFREAYAWLRHNTDVDDKVASWWDYGYQTTAMANRTVIVDNNTWNN
  THIATVGTAMSSPERAAWEIFHSLDVKYVLVVFGGLVGYPSDDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNCLMYKLSYYRFVETDG
  KGFDRVRQTEIGKKY
Full Sequence
Protein Sequence     Length: 575     Download
MVCSWGGYTF IINLIPMHVL LCIVTGRFSS RLYIAYAPLV VLGTLLAALV PVVGFNAVMT    60
SEHFASFLVF IIIHVVAFVY YIKGILSPKM FKVAVTLVVS VGLAVCCAVI AVLIALVASS    120
PTKGWSGRSL SLLDPTYASK YIPIIASVSE HQPPTWPSYF MDINVLAFLV PAGIIACFLP    180
LSDASSFVVL YIATSVYFSG VMVRLMLVLA PAACITSGIA LSQAFDVFTG SIKFQLTGAS    240
SNTEVDAAET SSSTAESQTD AVKTEKPEET AKNRPSRKSK KKEREHGEKP STEAKAEKKR    300
LLALPLESSV ISLLLLVLLG AFYVVHCVWA AAEAYSAPSI VLTSRSHDGL HVFDDFREAY    360
AWLRHNTDVD DKVASWWDYG YQTTAMANRT VIVDNNTWNN THIATVGTAM SSPERAAWEI    420
FHSLDVKYVL VVFGGLVGYP SDDINKFLWM VRIGGGVFPH IKEPDYLRDG QYRIDSQATP    480
TMLNCLMYKL SYYRFVETDG KGFDRVRQTE IGKKYFKLTH FEEAFTTHHW MVRIYKLKPP    540
KNRIRGKTKK SKSKTSSTTS SPKRSGTKKK NPWQ*                               600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG1287COG12873.0e-12328545244+
COG1287COG12871.0e-131233241+
pfam02516STT32.0e-251227236+
pfam02516STT39.0e-32321497186+
Gene Ontology
GO TermDescription
GO:0004576oligosaccharyl transferase activity
GO:0006486protein glycosylation
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_001146306.101574160718hypothetical protein LOC100279881 [Zea mays]
RefSeqNP_568380.101573210778STT3A (STAUROSPORIN AND TEMPERATURE SENSITIVE 3-LIKE A); oligosaccharyl transferase [Arabidopsis thaliana]
RefSeqXP_002280521.101574207778PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002325019.101552210759predicted protein [Populus trichocarpa]
RefSeqXP_002514244.101574208779oligosaccharyl transferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2lgz_A032656520263A Chain A, Solution Structure Of Stt3p
PDB3vu0_C0.000023554716123A Chain A, Crystal Structure Of The C-terminal Globular Domain Of Oligosaccharyltransferase (afaglb-s2, Af_0040, O30195_arcfu) From Archaeoglobus Fulgidus
PDB3vu0_B0.000023554716123A Chain A, Crystal Structure Of The C-terminal Globular Domain Of Oligosaccharyltransferase (afaglb-s2, Af_0040, O30195_arcfu) From Archaeoglobus Fulgidus
PDB3vu0_A0.000023554716123A Chain A, Crystal Structure Of The C-terminal Globular Domain Of Oligosaccharyltransferase (afaglb-s2, Af_0040, O30195_arcfu) From Archaeoglobus Fulgidus
Transmembrane Domains
StartEnd
426
3355
6582
95117
159181
186208
310332
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO778867533145460
HO47639754945430
HO7969143601875460
HO778867161161.8
HO796914201801995.3
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01458.1Aquca_001_00320.1
Arabidopsis lyrata891007488863
Arabidopsis thalianaAT1G34130.1AT5G19690.1
Brachypodium distachyonBradi5g26030.1Bradi2g49640.1Bradi2g19510.1
Brassica rapaBra028034Bra006514Bra002255Bra034441
Carica papayaevm.model.supercontig_467.1.248.439evm.model.supercontig_467.1.248.439evm.model.supercontig_40.47
Capsella rubellaCarubv10008402mCarubv10000271m
Chlamydomonas reinhardtiiCre07.g330100.t1.2g9581.t1
Citrus clementinaCiclev10019005mCiclev10019106mCiclev10007574mCiclev10007513mCiclev10007684m
Citrus sinensisorange1.1g004635morange1.1g005395morange1.1g004678morange1.1g003973m
Cucumis sativusCucsa.122250.1Cucsa.122250.2Cucsa.329260.1Cucsa.329260.2
Eucalyptus grandisEucgr.K02314.1Eucgr.C01008.1
Fragaria vescamrna09173.1-v1.0-hybridmrna11885.1-v1.0-hybrid
Glycine maxGlyma16g33881.1Glyma09g29470.1Glyma01g01270.1Glyma16g08410.1
Gossypium raimondiiGorai.013G004300.1Gorai.013G004300.2Gorai.011G219600.1Gorai.011G219600.4Gorai.011G219600.3
Gorai.011G219600.2Gorai.011G219600.5Gorai.013G229700.1Gorai.010G075800.1Gorai.010G075800.2
Linum usitatissimumLus10041985Lus10017990Lus10043241Lus10011124
Malus domesticaMDP0000299027MDP0000589608MDP0000158858MDP0000201702MDP0000300736
Manihot esculentacassava4.1_002347mcassava4.1_021540m
Medicago truncatulaMedtr6g077750.1Medtr6g077750.2Medtr1g114250.1
Mimulus guttatusmgv1a001976mmgv1a001650m
Oryza sativaLOC_Os04g57890.1LOC_Os05g44360.1LOC_Os05g44360.2
Panicum virgatumPavirv00017930mPavirv00007453mPavirv00022940mPavirv00024588mPavirv00056880m
Pavirv00065583m
Physcomitrella patensPp1s98_21V6.1Pp1s404_37V6.1Pp1s404_38V6.1
Phaseolus vulgarisPhvul.004G139400.1Phvul.004G170000.1
Picea abiesMA_174842g0010MA_10216317g0010MA_5501292g0010MA_10436134g0010
Populus trichocarpaPotri.012G036300.1Potri.015G028300.1Potri.015G028300.2Potri.018G086000.2Potri.018G086000.1
Potri.006G163600.1
Prunus persicappa001886mppa001464m
Ricinus communis30189.m00167429912.m005461
Setaria italicaSi021341mSi000402mSi021271mSi021321m
Selaginella moellendorffii110405118919
Sorghum bicolorSb06g032800.1Sb09g025920.1Sb03g034385.1
Thellungiella halophilaThhalv10006908mThhalv10012742m
Vitis viniferaGSVIVT01015322001GSVIVT01029339001
Volvox carteriVocar20013212mVocar20003562m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)