y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.010G077100.2
FamilyGT21
Protein PropertiesLength: 521 Molecular Weight: 58725.9 Isoelectric Point: 8.4064
ChromosomeChromosome/Scaffold: 10 Start: 11145238 End: 11151265
DescriptionNucleotide-diphospho-sugar transferases superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT21852603.1e-34
  PRVTVVMPLKGFGEHNLHNWKSQITSLYGGPLEFLFVVESTEDPAYHAVSRLIRDFKDDVDAKIILAGLSTTCSQKIHNQLVGVERMHKDTKYVLFLDDD
  VRLHPGSIGALTAEMEKKPEIFIQTGYPLDLPSGSLGSYCIYEYHMPCSMGFATGGKTFFLWGGCMMMHADDFRRD
Full Sequence
Protein Sequence     Length: 521     Download
MSAALDPVDW LLFSLSRAFR SPLSVFVQIQ GCVICLTLAI GWAFAAYVRN REINRMKDAM    60
KCGNSFAFLC HDINELEHTN QVNLPRVTVV MPLKGFGEHN LHNWKSQITS LYGGPLEFLF    120
VVESTEDPAY HAVSRLIRDF KDDVDAKIIL AGLSTTCSQK IHNQLVGVER MHKDTKYVLF    180
LDDDVRLHPG SIGALTAEME KKPEIFIQTG YPLDLPSGSL GSYCIYEYHM PCSMGFATGG    240
KTFFLWGGCM MMHADDFRRD NYGVVSGLRD GGYSDDMTLA AIAGAHKRLI TSPPVAVFPH    300
PLASDLSFSR YWNYLRKQTF VLESYISRVN WLMNRGLFSF HCYLSWGFVA PYFMAAVHIA    360
AALQIYIKGY SYEETTCTTS GLLLASCLAI CTLTELLSMW NLTRIEVQLC NMLSPEAPKL    420
SLDYYNWSLI FVALLVDNFL YPISAFRSHF SQSINWSGIR YHLKNGKINK IERNRGRGPK    480
FTDLGGKHLY GKKGAPPKAS FLSSLARSLC QWHQPKKYEV *                        540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam13632Glyco_trans_2_39.0e-6177363195+
pfam13641Glyco_tranf_2_36.0e-685259181+
cd02520Glucosylceramide_synthase9.0e-985203122+
COG1215COG12159.0e-1180443381+
pfam13506Glyco_transf_216.0e-11144316178+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAK73021.1015201520AF367245_1 ceramide glucosyltransferase [Gossypium arboreum]
GenBankABK95617.1015201517unknown [Populus trichocarpa]
RefSeqNP_565460.1035202519ceramide glucosyltransferase, putative [Arabidopsis thaliana]
RefSeqXP_002329645.101151911523predicted protein [Populus trichocarpa]
RefSeqXP_002514215.1025194521ceramide glucosyltransferase, putative [Ricinus communis]
Transmembrane Domains
StartEnd
2648
344366
381403
424446
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
JK7912682552625160
FE6984232891254130
DT4744412851784620
DV125113265963600
EX2798212822405210
Orthologous Group
SpeciesID
Arabidopsis lyrata319569
Arabidopsis thalianaAT2G19880.1AT2G19880.2
Brachypodium distachyonBradi2g58060.1
Brassica rapaBra036698Bra039028Bra031106
Carica papayaevm.model.supercontig_40.95
Capsella rubellaCarubv10013384m
Citrus clementinaCiclev10008006m
Citrus sinensisorange1.1g010062m
Cucumis sativusCucsa.288830.1
Eucalyptus grandisEucgr.C03729.1
Fragaria vescamrna11297.1-v1.0-hybrid
Glycine maxGlyma08g03760.1Glyma01g01130.1Glyma05g35860.2Glyma16g08510.1
Gossypium raimondiiGorai.010G077100.1Gorai.009G027500.1Gorai.009G027500.2
Linum usitatissimumLus10034973
Malus domesticaMDP0000289917MDP0000035240MDP0000126193
Manihot esculentacassava4.1_005602mcassava4.1_007721m
Medicago truncatulaMedtr8g102490.1Medtr8g102500.1
Mimulus guttatusmgv1a004497mmgv1a004580m
Oryza sativaLOC_Os01g67870.1
Panicum virgatumPavirv00019095mPavirv00063321m
Physcomitrella patensPp1s194_131V6.1
Phaseolus vulgarisPhvul.004G176200.1Phvul.002G308700.1
Populus trichocarpaPotri.018G087700.3Potri.018G087700.2Potri.018G087700.1Potri.006G164800.2Potri.T063300.1
Potri.006G164800.1
Prunus persicappa004285mppa005382m
Ricinus communis29912.m005431
Setaria italicaSi001058m
Selaginella moellendorffii74622
Sorghum bicolorSb03g043150.1
Thellungiella halophilaThhalv10001962m
Vitis viniferaGSVIVT01015303001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny