y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.010G092100.1
FamilyGT22
Protein PropertiesLength: 555 Molecular Weight: 63509.3 Isoelectric Point: 9.8431
ChromosomeChromosome/Scaffold: 10 Start: 14599784 End: 14605861
DescriptionAlg9-like mannosyltransferase family
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT22484620
  FLTCLGFRMLNALLIQTYFNPDEHWQALEVAHRIAFGYGHLTWEWEEGIRSYLHPMMFALFYKLLALLRLDTPCVMIKAPRLLQSIFSAVGDLYLYKLSF
  ALFGDGVAKWALFSQLANWFMFFCFNRTFSNSLETTLTLVGLYYWPSVRSSLNKAPSGSRKWGLALAALACAIRPTSAVTWVYVGLLELYSTHDRLRFIF
  VELIPIGSVVLGITCLLDRLMYDSWVLVPLNFLKFNFLSSGGDYYGTHKWHWYFTQGFTVMVFTFLPFCVAGIIKSKYWKLSGLILWVLGLYSILGHKEF
  RNSASSVNCRFVLPVLPISLIFAGYSLAALEERGSRNGEKKRSSCICNKWPSRKQLAIFFLLASNIPMALYMNLIHQRGAEDAMNYLSKEAAKGKVKSIV
  FLMPCHATPYYSTLH
Full Sequence
Protein Sequence     Length: 555     Download
MKHSVLQSQL KSIKMRQRKN GSSIKHPNLS DAEAKPQKKS PYSSKDVFLT CLGFRMLNAL    60
LIQTYFNPDE HWQALEVAHR IAFGYGHLTW EWEEGIRSYL HPMMFALFYK LLALLRLDTP    120
CVMIKAPRLL QSIFSAVGDL YLYKLSFALF GDGVAKWALF SQLANWFMFF CFNRTFSNSL    180
ETTLTLVGLY YWPSVRSSLN KAPSGSRKWG LALAALACAI RPTSAVTWVY VGLLELYSTH    240
DRLRFIFVEL IPIGSVVLGI TCLLDRLMYD SWVLVPLNFL KFNFLSSGGD YYGTHKWHWY    300
FTQGFTVMVF TFLPFCVAGI IKSKYWKLSG LILWVLGLYS ILGHKEFRNS ASSVNCRFVL    360
PVLPISLIFA GYSLAALEER GSRNGEKKRS SCICNKWPSR KQLAIFFLLA SNIPMALYMN    420
LIHQRGAEDA MNYLSKEAAK GKVKSIVFLM PCHATPYYST LHNNLPMRFL DCAPSKGMPA    480
ESDRFMMDPV SFAVDFAKNW SRPSHIVLFD SEERHLKDFL VSHSFREVRR FFHAHFKVDR    540
DLQASVVVYA MTDS*                                                     600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03901Glyco_transf_223.0e-11347462436+
PLN02816PLN02816043554520+
Gene Ontology
GO TermDescription
GO:0006506GPI anchor biosynthetic process
GO:0016757transferase activity, transferring glycosyl groups
GO:0031227intrinsic to endoplasmic reticulum membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN70801.10515523497hypothetical protein [Vitis vinifera]
EMBLCBI36602.101955296624unnamed protein product [Vitis vinifera]
RefSeqNP_568305.104355437546mannosyltransferase, putative [Arabidopsis thaliana]
RefSeqXP_002271446.10155521539PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002513232.1075525536glycosyltransferase, putative [Ricinus communis]
Transmembrane Domains
StartEnd
176195
210232
245267
299321
326343
358377
403422
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7914053101904970
HO413864526585470
GO8453593621655120
EV117564237432790
CF4470552712375050
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_016_00400.3Aquca_016_00400.1Aquca_016_00400.2
Arabidopsis lyrata861876
Arabidopsis thalianaAT5G14850.1AT5G14850.2
Brachypodium distachyonBradi3g01150.1
Brassica rapaBra023489
Carica papayaevm.model.supercontig_42.125
Capsella rubellaCarubv10000649m
Citrus clementinaCiclev10007971m
Citrus sinensisorange1.1g009445morange1.1g010488m
Cucumis sativusCucsa.351020.4Cucsa.351020.2Cucsa.351020.1Cucsa.351020.3
Eucalyptus grandisEucgr.C00228.1
Fragaria vescamrna04987.1-v1.0-hybrid
Glycine maxGlyma13g01500.1Glyma17g07620.2
Gossypium raimondiiGorai.010G092100.8Gorai.010G092100.7Gorai.010G092100.6Gorai.010G092100.4Gorai.010G092100.3
Gorai.010G092100.2Gorai.010G092100.5
Linum usitatissimumLus10033341Lus10033296Lus10034759
Manihot esculentacassava4.1_005070m
Medicago truncatulaMedtr4g129500.1
Mimulus guttatusmgv1a004248m
Oryza sativaLOC_Os01g39810.4LOC_Os01g39810.3LOC_Os01g39810.2LOC_Os01g39810.1LOC_Os02g02110.1
Panicum virgatumPavirv00059707mPavirv00064501m
Physcomitrella patensPp1s32_143V6.1
Phaseolus vulgarisPhvul.003G151000.1
Picea abiesMA_10430738g0010
Populus trichocarpaPotri.018G098700.3Potri.018G098700.1Potri.018G098700.2
Prunus persicappa003843m
Ricinus communis30225.m001678
Setaria italicaSi016829m
Selaginella moellendorffii105923
Sorghum bicolorSb09g025250.1
Thellungiella halophilaThhalv10013155m
Vitis viniferaGSVIVT01023723001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny