y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.010G092100.5
FamilyGT22
Protein PropertiesLength: 533 Molecular Weight: 61137.5 Isoelectric Point: 9.7499
ChromosomeChromosome/Scaffold: 10 Start: 14599784 End: 14605861
DescriptionAlg9-like mannosyltransferase family
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT22344400
  FLTCLGFRMLNALLIQTYFNPDEHWQALEVAHRIAFGRYGHLTWEWEEGIRSYLHPMMFALFYKLLALLRLDTPCVMIKAPRLLQSIFSAVGDLYLYKLS
  FALFGDGVAKWALFSQLANWFMFFCFNRTFSNSLETTLTLVGLYYWPSVRSSLNKAPSGSRKWGLALAALACAIRPTSAVTWVYVGLLELYSTHDRLRFI
  FVELIPIGSVVLGITCLLDRLMYDSWVLVPLNFLKFNFLSSGGDYYGTHKWHWYFTQGFTVMVFTFLPFCVAGIIKSKYWKLSGLILWVLGLYSILGHKE
  FRFVLPVLPISLIFAGYSLAALEERGSRNGEKKRSSCICNKWPSRKQLAIFFLLASNIPMALYMNLIHQRGAEDAMNYLSKEAAKGKVKSIVFLMPCHAT
  PYYSTLH
Full Sequence
Protein Sequence     Length: 533     Download
MRQRKNGSSI KHPNLSDAEA KPQKKSPYSS KDVFLTCLGF RMLNALLIQT YFNPDEHWQA    60
LEVAHRIAFG RYGHLTWEWE EGIRSYLHPM MFALFYKLLA LLRLDTPCVM IKAPRLLQSI    120
FSAVGDLYLY KLSFALFGDG VAKWALFSQL ANWFMFFCFN RTFSNSLETT LTLVGLYYWP    180
SVRSSLNKAP SGSRKWGLAL AALACAIRPT SAVTWVYVGL LELYSTHDRL RFIFVELIPI    240
GSVVLGITCL LDRLMYDSWV LVPLNFLKFN FLSSGGDYYG THKWHWYFTQ GFTVMVFTFL    300
PFCVAGIIKS KYWKLSGLIL WVLGLYSILG HKEFRFVLPV LPISLIFAGY SLAALEERGS    360
RNGEKKRSSC ICNKWPSRKQ LAIFFLLASN IPMALYMNLI HQRGAEDAMN YLSKEAAKGK    420
VKSIVFLMPC HATPYYSTLH NNLPMRFLDC APSKGMPAES DRFMMDPVSF AVDFAKNWSR    480
PSHIVLFDSE ERHLKDFLVS HSFREVRRFF HAHFKVDRDL QASVVVYAMT DS*           540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03901Glyco_transf_222.0e-11333440428+
PLN02816PLN02816029532512+
Gene Ontology
GO TermDescription
GO:0006506GPI anchor biosynthetic process
GO:0016757transferase activity, transferring glycosyl groups
GO:0031227intrinsic to endoplasmic reticulum membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN70801.10375303497hypothetical protein [Vitis vinifera]
EMBLCBI36602.10553096624unnamed protein product [Vitis vinifera]
RefSeqNP_568305.102953237546mannosyltransferase, putative [Arabidopsis thaliana]
RefSeqXP_002271446.1015301539PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002513232.10253013536glycosyltransferase, putative [Ricinus communis]
Transmembrane Domains
StartEnd
163182
197219
232254
286308
313330
334356
381400
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7914053011774750
GO8453593531524900
HO413864518445250
CF4470552622244830
EY9131012511734230
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_016_00400.3Aquca_016_00400.1Aquca_016_00400.2
Arabidopsis lyrata861876
Arabidopsis thalianaAT5G14850.1AT5G14850.2
Brachypodium distachyonBradi3g01150.1
Brassica rapaBra023489
Carica papayaevm.model.supercontig_42.125
Capsella rubellaCarubv10000649m
Citrus clementinaCiclev10007971m
Citrus sinensisorange1.1g009445morange1.1g010488m
Cucumis sativusCucsa.351020.4Cucsa.351020.2Cucsa.351020.1Cucsa.351020.3
Eucalyptus grandisEucgr.C00228.1
Fragaria vescamrna04987.1-v1.0-hybrid
Glycine maxGlyma13g01500.1Glyma17g07620.2
Gossypium raimondiiGorai.010G092100.8Gorai.010G092100.1Gorai.010G092100.7Gorai.010G092100.6Gorai.010G092100.4
Gorai.010G092100.3Gorai.010G092100.2
Linum usitatissimumLus10033341Lus10033296Lus10034759
Manihot esculentacassava4.1_005070m
Medicago truncatulaMedtr4g129500.1
Mimulus guttatusmgv1a004248m
Oryza sativaLOC_Os01g39810.4LOC_Os01g39810.3LOC_Os01g39810.2LOC_Os01g39810.1LOC_Os02g02110.1
Panicum virgatumPavirv00059707mPavirv00064501m
Physcomitrella patensPp1s32_143V6.1
Phaseolus vulgarisPhvul.003G151000.1
Picea abiesMA_10430738g0010
Populus trichocarpaPotri.018G098700.3Potri.018G098700.1Potri.018G098700.2
Prunus persicappa003843m
Ricinus communis30225.m001678
Setaria italicaSi016829m
Selaginella moellendorffii105923
Sorghum bicolorSb09g025250.1
Thellungiella halophilaThhalv10013155m
Vitis viniferaGSVIVT01023723001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny