y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.010G092100.8
FamilyGT22
Protein PropertiesLength: 279 Molecular Weight: 32118.5 Isoelectric Point: 9.6576
ChromosomeChromosome/Scaffold: 10 Start: 14603079 End: 14605880
DescriptionAlg9-like mannosyltransferase family
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT2211860
  MYDSWVLVPLNFLKFNFLSSGGDYYGTHKWHWYFTQGFTVMVFTFLPFCVAGIIKSKYWKLSGLILWVLGLYSILGHKEFRFVLPVLPISLIFAGYSLAA
  LEERGSRNGEKKRSSCICNKWPSRKQLAIFFLLASNIPMALYMNLIHQRGAEDAMNYLSKEAAKGKVKSIVFLMPCHATPYYSTLH
Full Sequence
Protein Sequence     Length: 279     Download
MYDSWVLVPL NFLKFNFLSS GGDYYGTHKW HWYFTQGFTV MVFTFLPFCV AGIIKSKYWK    60
LSGLILWVLG LYSILGHKEF RFVLPVLPIS LIFAGYSLAA LEERGSRNGE KKRSSCICNK    120
WPSRKQLAIF FLLASNIPMA LYMNLIHQRG AEDAMNYLSK EAAKGKVKSI VFLMPCHATP    180
YYSTLHNNLP MRFLDCAPSK GMPAESDRFM MDPVSFAVDF AKNWSRPSHI VLFDSEERHL    240
KDFLVSHSFR EVRRFFHAHF KVDRDLQASV VVYAMTDS*                           300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03901Glyco_transf_224.0e-461186198+
PLN02816PLN028162.0e-1381278286+
Gene Ontology
GO TermDescription
GO:0006506GPI anchor biosynthetic process
GO:0016757transferase activity, transferring glycosyl groups
GO:0031227intrinsic to endoplasmic reticulum membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN70801.101276220497hypothetical protein [Vitis vinifera]
EMBLCBI36602.101276347624unnamed protein product [Vitis vinifera]
RefSeqNP_568305.101278261546mannosyltransferase, putative [Arabidopsis thaliana]
RefSeqXP_002271446.101276262539PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002324502.1012771277predicted protein [Populus trichocarpa]
Transmembrane Domains
StartEnd
3254
5976
80102
127146
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO979658238312660
GO845558268122770
HO79140522312210
FD49341122512230
CV708518229532790
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_016_00400.3Aquca_016_00400.1Aquca_016_00400.2
Arabidopsis lyrata861876
Arabidopsis thalianaAT5G14850.1AT5G14850.2
Brachypodium distachyonBradi3g01150.1
Brassica rapaBra023489
Carica papayaevm.model.supercontig_42.125
Capsella rubellaCarubv10000649m
Citrus clementinaCiclev10007971m
Citrus sinensisorange1.1g009445morange1.1g010488m
Cucumis sativusCucsa.351020.4Cucsa.351020.2Cucsa.351020.1Cucsa.351020.3
Eucalyptus grandisEucgr.C00228.1
Fragaria vescamrna04987.1-v1.0-hybrid
Glycine maxGlyma13g01500.1Glyma17g07620.2
Gossypium raimondiiGorai.010G092100.1Gorai.010G092100.7Gorai.010G092100.6Gorai.010G092100.4Gorai.010G092100.3
Gorai.010G092100.2Gorai.010G092100.5
Linum usitatissimumLus10033341Lus10033296Lus10034759
Manihot esculentacassava4.1_005070m
Medicago truncatulaMedtr4g129500.1
Mimulus guttatusmgv1a004248m
Oryza sativaLOC_Os01g39810.4LOC_Os01g39810.3LOC_Os01g39810.2LOC_Os01g39810.1LOC_Os02g02110.1
Panicum virgatumPavirv00059707mPavirv00064501m
Physcomitrella patensPp1s32_143V6.1
Phaseolus vulgarisPhvul.003G151000.1
Picea abiesMA_10430738g0010
Populus trichocarpaPotri.018G098700.3Potri.018G098700.1Potri.018G098700.2
Prunus persicappa003843m
Ricinus communis30225.m001678
Setaria italicaSi016829m
Selaginella moellendorffii105923
Sorghum bicolorSb09g025250.1
Thellungiella halophilaThhalv10013155m
Vitis viniferaGSVIVT01023723001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny