y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.010G194400.1
FamilyAA1
Protein PropertiesLength: 354 Molecular Weight: 39082.2 Isoelectric Point: 7.8043
ChromosomeChromosome/Scaffold: 10 Start: 55365272 End: 55366797
Descriptionlaccase 5
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA1223500
  AEVQRHRFVIQATKVKRLCKTHNIITVNGMFPGPTLEIKNGDTLEVQVVNKARYNVTIHWHGVRQMRTGWADGPDFVTRCPIRPGGSCTYRFTVQGQEGT
  LWWHAHSSWLRATVYGALESFSVTNTNDYDDQSEMEATRTGAAPNVSDAYTINAQSGDLYKCSSKETTVVPIDSGETNLLRVINAALNQPLFFKVANHKL
  TVVGADASYTKPFTTSVLMLGPGQTTDVLIQGDQPPSRHYMAARDYQRAQNAPFDNTATTAILEYKFASCAAKKCNGPTPIMPSLPAYNDTNTVTAFSQS
  FRSREKAEVPTDIDESLFFTIGLELNNCP
Full Sequence
Protein Sequence     Length: 354     Download
MGIFNKFSFI FLVIFLALSA NAEVQRHRFV IQATKVKRLC KTHNIITVNG MFPGPTLEIK    60
NGDTLEVQVV NKARYNVTIH WHGVRQMRTG WADGPDFVTR CPIRPGGSCT YRFTVQGQEG    120
TLWWHAHSSW LRATVYGALE SFSVTNTNDY DDQSEMEATR TGAAPNVSDA YTINAQSGDL    180
YKCSSKETTV VPIDSGETNL LRVINAALNQ PLFFKVANHK LTVVGADASY TKPFTTSVLM    240
LGPGQTTDVL IQGDQPPSRH YMAARDYQRA QNAPFDNTAT TAILEYKFAS CAAKKCNGPT    300
PIMPSLPAYN DTNTVTAFSQ SFRSREKAEV PTDIDESLFF TIGLELNNCP PNL*          360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02191PLN021914.0e-3310320352+
PLN02604PLN026042.0e-401326366+
TIGR03388ascorbase8.0e-4340340350+
pfam07732Cu-oxidase_38.0e-5230139112+
TIGR03389laccase1.0e-16022352354+
Gene Ontology
GO TermDescription
GO:0005507copper ion binding
GO:0016491oxidoreductase activity
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABK92474.10203534354unknown [Populus trichocarpa]
EMBLCAN75316.102235331381hypothetical protein [Vitis vinifera]
EMBLCBI25418.102235331381unnamed protein product [Vitis vinifera]
RefSeqXP_002273875.102235331381PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002315131.10835214378laccase 90c [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3sqr_A5e-274230185364A Chain A, Crystal Structure Of Laccase From Botrytis Aclada At 1.67 A Resolution
PDB3v9e_A5e-274230185364A Chain A, Structure Of The L513m Mutant Of The Laccase From B.aclada
PDB3div_A1e-264630425299A Chain A, Crystal Structure Of Laccase From Cerrena Maxima At 1.76a Resolution
PDB3pxl_A3e-264630425299A Chain A, Type-2 Cu-Depleted Fungus Laccase From Trametes Hirsuta
PDB3v9c_A3e-264630425299A Chain A, Type-2 Cu-Depleted Fungus Laccase From Trametes Hirsuta
Signal Peptide
Cleavage Site
22
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EX658195282192810
DY97229328972760
DY26357438853530
DV465023252212500
FC91775226752460
Orthologous Group
SpeciesID
Carica papayaevm.model.supercontig_2.357
Gossypium raimondiiGorai.009G323100.1Gorai.010G194200.1
Panicum virgatumPavirv00067346m.31.314Pavirv00067346m.31.314
Picea abiesMA_10430789g0010MA_213397g0020MA_208475g0010.235.509MA_208475g0010.235.509MA_10435226g0010
MA_208475g0010.20.234MA_208475g0010.20.234MA_414479g0010
Setaria italicaSi034761m.31.313Si034761m.31.313
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny