y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.010G197300.1
FamilyPL1
Protein PropertiesLength: 351 Molecular Weight: 39009.3 Isoelectric Point: 9.8699
ChromosomeChromosome/Scaffold: 10 Start: 55802506 End: 55803796
DescriptionPectin lyase-like superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
PL11012990
  ITFKNSMTITLQRPLLLSSFTAIDGRGVDVHITGAGCLLVYQATDIIIHGLRIHHFKAQPPSTVMGTNAKVIPLGQMDGDAIRLVTARKVWIDHNTLYEC
  QDGLLDVTRGSTSITVLNNWFRNQDKVMLLGHDDGHLRDKNMKATVIFNHFGPNCNQRMPRVHHGYAHVANNFYQGWEQYAIGGSMSPSIKSEANFFVA
Full Sequence
Protein Sequence     Length: 351     Download
MATTLSCCFT LALFMVILMA SPSSSLANLN VIDKCWRGNP LWRSQRQQLA KCSVGFVGKM    60
INNIGKDVVK YKVIDPSDDP LSPKSGTLRY GTTMIKGKLW ITFKNSMTIT LQRPLLLSSF    120
TAIDGRGVDV HITGAGCLLV YQATDIIIHG LRIHHFKAQP PSTVMGTNAK VIPLGQMDGD    180
AIRLVTARKV WIDHNTLYEC QDGLLDVTRG STSITVLNNW FRNQDKVMLL GHDDGHLRDK    240
NMKATVIFNH FGPNCNQRMP RVHHGYAHVA NNFYQGWEQY AIGGSMSPSI KSEANFFVAP    300
TDVGNKEVTW RKGEKGLWKF YLVRDVVDAG FIKKLTSESG VLRCSRSLIC *             360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3866PelB9.0e-2685297231+
pfam00544Pec_lyase_C2.0e-54119297187+
smart00656Amb_all6.0e-62107300205+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_196490.10603131253pectate lyase family protein [Arabidopsis thaliana]
RefSeqXP_002267384.102435014369PREDICTED: similar to putative Cup s 1 pollen allergen [Vitis vinifera]
RefSeqXP_002299118.10293501354predicted protein [Populus trichocarpa]
RefSeqXP_002304865.10293501352predicted protein [Populus trichocarpa]
RefSeqXP_002527354.1093086307Major pollen allergen Jun v 1 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1pxz_B0303132284A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB1pxz_A0303132284A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB1vbl_A9e-17115319128354A Chain A, Structure Of The Thermostable Pectate Lyase Pl 47
PDB3zsc_A4e-169329942248A Chain A, Catalytic Function And Substrate Recognition Of The Pectate Lyase From Thermotoga Maritima
PDB1jta_A0.0000000000004180298144288A Chain A, Catalytic Function And Substrate Recognition Of The Pectate Lyase From Thermotoga Maritima
Transmembrane Domains
StartEnd
527
Signal Peptide
Cleavage Site
27
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DR808308257302790
FD7579992131133250
DT5757502251513450
EL457563283303110
DK472540274303020
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_035_00024.1Aquca_018_00074.1Aquca_015_00229.1
Arabidopsis lyrata487738881338
Arabidopsis thalianaAT5G09280.1AT1G30350.1
Brassica rapaBra009375Bra012756
Carica papayaevm.model.supercontig_42.185evm.model.supercontig_51.17
Capsella rubellaCarubv10002943mCarubv10006459m
Citrus sinensisorange1.1g041616m
Cucumis sativusCucsa.112490.1
Eucalyptus grandisEucgr.K02336.1
Fragaria vescamrna29291.1-v1.0-hybrid
Glycine maxGlyma11g06761.1Glyma01g38540.1Glyma16g25710.2Glyma13g21880.2
Gossypium raimondiiGorai.010G196700.1Gorai.010G196900.1Gorai.010G197000.1Gorai.010G197100.1Gorai.010G197400.1
Gorai.008G271800.1Gorai.008G271900.1Gorai.010G197600.1Gorai.010G197500.1Gorai.004G231500.1
Gorai.010G196800.1
Linum usitatissimumLus10031867Lus10031296
Malus domesticaMDP0000244018MDP0000233331MDP0000166129
Manihot esculentacassava4.1_026008mcassava4.1_024289mcassava4.1_025601mcassava4.1_023158m
Medicago truncatulaMedtr6g077900.1Medtr8g078350.1Medtr5g035840.1Medtr5g019060.1Medtr4g064420.1
Medtr3g030900.1Medtr8g078310.1Medtr8g078390.1Medtr8g078280.1Medtr5g019090.1
Medtr5g019170.1Medtr5g019160.1
Mimulus guttatusmgv1a021987m
Oryza sativaLOC_Os08g18970.1
Panicum virgatumPavirv00017566m
Physcomitrella patensPp1s385_14V6.1Pp1s45_65V6.1
Phaseolus vulgarisPhvul.004G101900.1Phvul.002G025800.1Phvul.004G098100.1Phvul.004G101600.1
Picea abiesMA_10433764g0010
Populus trichocarpaPotri.003G218200.1Potri.001G007400.1Potri.003G218200.2Potri.005G064500.2Potri.005G064500.1
Prunus persicappa016145mppa021860mppa016917mppa025917mppa016255m
Ricinus communis29596.m00070329743.m000300
Setaria italicaSi013945m
Selaginella moellendorffii88799
Sorghum bicolorSb03g036930.1
Thellungiella halophilaThhalv10015832m
Vitis viniferaGSVIVT01024239001
Zea maysAC233851.1_FGT011
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny