y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.010G239400.1
FamilyGT5
Protein PropertiesLength: 1053 Molecular Weight: 119221 Isoelectric Point: 5.8067
ChromosomeChromosome/Scaffold: 10 Start: 60896239 End: 60905027
Descriptionstarch synthase 4
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT555510390
  HVIHIAAEMAPVAKVGGLGDVVTGLGKALQKKGHLVEIVLPKYDCMQYDRIRDLRVLDATVYSYFDGKLFQNKVWTGTVEGLPVYFIEPHHPSKFFWRGQ
  YYGEQDDFKRFSFFSRAALELLLQVGKKPDIIHCHDWQTAFVAPLYWDLYFPKGLNSARICFTCHNFEYQGAAPASELASCGLDVQQLHRPDRMQDNSAH
  DRVNPIKGAIVFSNIVTTVSPTYAQEVRTAEGGKGLHSTLNFHSKKFMGILNGIDTDAWDPATDIFLKVQYTANDLQGKAENKAAMRRHLRLSSADDSQP
  LVGCITRLVPQKGVHLIRHAIYRTLEMGGQFVLLGSSPVPHIQREFEGIANQFQDHEHIRLILKYDESLSRYIYAASDMFIIPSIFEPCGLTQMIAMRYG
  SVPIVRKTGGLNDSVFDVDDDTIPYQYRNGFTFATPDEQGLNGALDRAFNLYNNDSETWQQLVQKNMNIDFSWSSSASQYEELYA
Full Sequence
Protein Sequence     Length: 1053     Download
MAARCSICFF SYGFNGLSEG NYGNDVDCWK KNVSLFLPSR RRLLPVCCKI QRRNLSSYNR    60
RQGKKPPFER IRPSAKLQPN SDDEFDPEHS VPNNGDMEPS VNREKTFEDD VDARGDAEHT    120
DEKNLGTQFA SAIETNRDVK HADEQITDSP AQSAVAKASA INGVGAELLS SVQPDDLIGM    180
IKNAERNILL LNQARVHALE DLHKILSEKE TLKGEINNLE KRLAEADAQI KFASQEKVHA    240
ELLEDQLENL QNELINRGGS GKSELELYEN RSKISNEGAL LARDGHIHSL SKEVDSLRTE    300
NLALKYDIQA LKSMLSNLKN TDKRIVTLEN ESSFLESSVK ELESKLSVSQ QESSNISTLK    360
TECKDLWAKV ENLQLLLDKA TKQADQAILV LQQNQDLRKK VDKLEESLEA ATIFKASSEK    420
TQQYNELMQQ KIKLLEERLQ KSDEEIYSYV QLYQESIKEF RDTLNSLKEE SKKRALDEPV    480
DDMPWEFWSC LLLTIDGWVL ENKILNSEAV PLREMVWKRD RRICDAYVIC KEKTEDEVIS    540
TFLQLISSQA SPGLHVIHIA AEMAPVAKVG GLGDVVTGLG KALQKKGHLV EIVLPKYDCM    600
QYDRIRDLRV LDATVYSYFD GKLFQNKVWT GTVEGLPVYF IEPHHPSKFF WRGQYYGEQD    660
DFKRFSFFSR AALELLLQVG KKPDIIHCHD WQTAFVAPLY WDLYFPKGLN SARICFTCHN    720
FEYQGAAPAS ELASCGLDVQ QLHRPDRMQD NSAHDRVNPI KGAIVFSNIV TTVSPTYAQE    780
VRTAEGGKGL HSTLNFHSKK FMGILNGIDT DAWDPATDIF LKVQYTANDL QGKAENKAAM    840
RRHLRLSSAD DSQPLVGCIT RLVPQKGVHL IRHAIYRTLE MGGQFVLLGS SPVPHIQREF    900
EGIANQFQDH EHIRLILKYD ESLSRYIYAA SDMFIIPSIF EPCGLTQMIA MRYGSVPIVR    960
KTGGLNDSVF DVDDDTIPYQ YRNGFTFATP DEQGLNGALD RAFNLYNNDS ETWQQLVQKN    1020
MNIDFSWSSS ASQYEELYAK SVARARAATS RT*                                 1080
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02316PLN023162.0e-1445521038494+
PLN02939PLN029390461042998+
TIGR02095glgA05541041491+
cd03791GT1_Glycogen_synthase_DULL1_like05551040491+
PRK00654glgA05541038488+
Gene Ontology
GO TermDescription
GO:0009058biosynthetic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACT09058.1032104925999starch synthase IV precursor [Solanum lycopersicum]
EMBLCAA16796.106105271071starch synthase-like protein [Arabidopsis thaliana]
RefSeqNP_193558.306105271040ATSS4; transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqXP_002274716.101104911009PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002298514.10156105114887predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1rzv_B055410451479A Chain A, Crystal Structure Of The Glycogen Synthase From Agrobacterium Tumefaciens (Non-Complexed Form)
PDB1rzv_A055410451479A Chain A, Crystal Structure Of The Glycogen Synthase From Agrobacterium Tumefaciens (Non-Complexed Form)
PDB1rzu_B055410451479A Chain A, Crystal Structure Of The Glycogen Synthase From A. Tumefaciens In Complex With Adp
PDB1rzu_A055410451479A Chain A, Crystal Structure Of The Glycogen Synthase From A. Tumefaciens In Complex With Adp
PDB3guh_A055410401475A Chain A, Crystal Structure Of The Glycogen Synthase From A. Tumefaciens In Complex With Adp
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO8511323336299610
CF8287762856809640
GW8656162986609570
EL4488773164827970
CB8938183075278330
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_037_00066.2Aquca_037_00066.1Aquca_037_00193.1Aquca_022_00123.1Aquca_002_00621.1
Aquca_022_00123.2Aquca_022_00123.3Aquca_009_00525.1
Arabidopsis lyrata473472477411489289358769
Arabidopsis thalianaAT1G32900.1AT3G01180.1AT5G24300.2AT5G24300.1AT4G18240.1
AT5G65685.2AT5G65685.1
Brachypodium distachyonBradi2g41590.5Bradi2g41590.1Bradi2g41590.2Bradi1g50090.1Bradi1g48610.1
Bradi3g27260.1Bradi1g45130.1Bradi3g59440.1Bradi2g18810.1
Brassica rapaBra010189Bra039138Bra009747Bra021017Bra019836.229.497
Bra021487Bra024412
Carica papayaevm.model.supercontig_37.97evm.model.supercontig_3.93evm.TU.contig_36490.1evm.model.supercontig_17.97.762.945evm.model.supercontig_17.97.762.945
evm.model.supercontig_17.97.532.764evm.model.supercontig_17.97.532.764evm.model.supercontig_14.93evm.model.supercontig_129.30
Capsella rubellaCarubv10008624mCarubv10008699mCarubv10013000mCarubv10000355mCarubv10006702m
Carubv10026302m
Chlamydomonas reinhardtiiCre17.g721500.t1.2Cre03.g185250.t1.2Cre12.g521700.t1.2Cre04.g215150.t1.2Cre04.g215150.t2.1
Cre16.g665800.t1.2Cre16.g663850.t1.3Cre13.g579600.t1.3.129.404Cre13.g579600.t1.3.129.404Cre13.g579600.t2.1.136.412
Cre13.g579600.t2.1.136.412
Citrus clementinaCiclev10019346mCiclev10019349mCiclev10019815mCiclev10011124mCiclev10019612m
Ciclev10014107mCiclev10014142mCiclev10014319m.362.794Ciclev10007868mCiclev10014157m
Ciclev10008656mCiclev10025051mCiclev10025212m
Citrus sinensisorange1.1g007247morange1.1g007224morange1.1g007212morange1.1g007300morange1.1g007873m
orange1.1g010448morange1.1g008488morange1.1g008478morange1.1g008028morange1.1g010752m
orange1.1g010732morange1.1g012874morange1.1g008154morange1.1g006091morange1.1g007370m
orange1.1g009139morange1.1g006770morange1.1g007130morange1.1g043397morange1.1g011755m
orange1.1g002628morange1.1g004879morange1.1g002589morange1.1g003536morange1.1g015531m
orange1.1g015971morange1.1g011163morange1.1g009217morange1.1g005005m
Cucumis sativusCucsa.193420.1Cucsa.338760.1Cucsa.047530.3Cucsa.047530.1Cucsa.047530.2
Cucsa.338780.1Cucsa.103660.4Cucsa.103660.3Cucsa.103660.2Cucsa.103660.1
Eucalyptus grandisEucgr.E01068.4Eucgr.E01068.3Eucgr.E01068.2Eucgr.E01068.1Eucgr.K00387.1
Eucgr.J01349.1Eucgr.K00387.2Eucgr.J01349.3Eucgr.K00387.3Eucgr.J01349.2.414.725
Eucgr.J01349.2.414.725Eucgr.D00323.1Eucgr.C02159.1Eucgr.C02159.2.288.565Eucgr.C02159.2.288.565
Eucgr.J01349.2.300.414Eucgr.J01349.2.300.414Eucgr.H02402.1Eucgr.D01324.4.738.899Eucgr.D01324.4.738.899
Eucgr.C02159.2.116.286Eucgr.C02159.2.116.286
Fragaria vescamrna18627.1-v1.0-hybridmrna01870.1-v1.0-hybridmrna12887.1-v1.0-hybridmrna04452.1-v1.0-hybridmrna30547.1-v1.0-hybrid
mrna29878.1-v1.0-hybridmrna05617.1-v1.0-hybrid
Glycine maxGlyma07g05580.4Glyma07g05580.3Glyma16g02110.4Glyma16g02110.3Glyma20g36040.1
Glyma10g31540.4Glyma10g31540.3Glyma13g05441.1Glyma19g02690.1Glyma04g41370.1
Glyma06g13480.1Glyma05g25790.1Glyma08g08740.2Glyma18g49480.1Glyma01g02321.2
Glyma01g02321.1Glyma09g33665.1
Gossypium raimondiiGorai.004G128700.6Gorai.004G128700.5Gorai.004G128700.3Gorai.004G128700.2Gorai.004G128700.11
Gorai.004G128700.1Gorai.006G205000.2Gorai.006G205000.1Gorai.008G260100.2Gorai.008G260100.1
Gorai.004G128700.9Gorai.004G128700.8Gorai.004G128700.7Gorai.004G128700.12Gorai.004G128700.10
Gorai.004G128700.4.84.380Gorai.004G128700.4.84.380Gorai.001G239200.1Gorai.006G016400.1Gorai.012G002300.1
Gorai.006G201600.1Gorai.004G128700.4.376.521Gorai.004G128700.4.376.521Gorai.009G348800.1Gorai.011G041700.1
Gorai.006G016400.2Gorai.011G041700.2Gorai.011G041700.3Gorai.010G239400.3Gorai.010G135300.1
Gorai.010G135300.2Gorai.003G034900.2Gorai.003G034900.1Gorai.003G034900.3Gorai.010G239400.2.555.786
Gorai.010G239400.2.555.786
Linum usitatissimumLus10033245Lus10008279Lus10033014Lus10022398Lus10018116
Lus10015371Lus10038491Lus10023319Lus10028133Lus10042837
Malus domesticaMDP0000247496MDP0000095637MDP0000295223MDP0000272992MDP0000122981
MDP0000310374MDP0000283839MDP0000199149MDP0000297460MDP0000232524
MDP0000842179MDP0000195502MDP0000235176.515.815MDP0000235176.515.815MDP0000235176.817.958
MDP0000235176.817.958MDP0000118804.728.869MDP0000118804.728.869MDP0000280416MDP0000118804.567.726
MDP0000118804.567.726MDP0000147708MDP0000311338MDP0000276358MDP0000252413.662.857
MDP0000252413.662.857
Manihot esculentacassava4.1_003916mcassava4.1_003898mcassava4.1_003887mcassava4.1_003884mcassava4.1_002278m
cassava4.1_004619mcassava4.1_028098mcassava4.1_000719mcassava4.1_001042m.519.962cassava4.1_004857m
cassava4.1_003886mcassava4.1_003800mcassava4.1_010181mcassava4.1_033706m
Medicago truncatulaMedtr6g012380.1Medtr3g091570.1Medtr7g037650.1Medtr5g030590.1Medtr5g030600.1
Mimulus guttatusmgv1a003021mmgv1a003015mmgv1a002012mmgv1a005697mmgv1a000652m
mgv1a020828mmgv11b018884m
Oryza sativaLOC_Os07g22930.3LOC_Os07g22930.2LOC_Os07g22930.4LOC_Os06g04200.4LOC_Os06g04200.3
LOC_Os06g04200.2LOC_Os06g04200.1LOC_Os06g12450.1LOC_Os10g30156.1LOC_Os06g06560.1
LOC_Os02g51070.1LOC_Os01g52250.4LOC_Os01g52250.3LOC_Os01g52250.2LOC_Os01g52250.1
LOC_Os05g45720.1LOC_Os01g52250.5LOC_Os01g52250.6LOC_Os05g45720.3LOC_Os05g45720.2.423.721
LOC_Os05g45720.2.423.721LOC_Os05g45720.4LOC_Os05g45720.2.723.863LOC_Os05g45720.2.723.863LOC_Os02g56320.1
Panicum virgatumPavirv00034639mPavirv00034640mPavirv00009513mPavirv00009514mPavirv00034641m
Pavirv00054240mPavirv00057044mPavirv00017007mPavirv00068567mPavirv00002063m
Pavirv00026758mPavirv00032012mPavirv00030577mPavirv00021634mPavirv00031531m
Pavirv00026181mPavirv00031532mPavirv00009008mPavirv00021114mPavirv00002424m
Pavirv00041882m
Physcomitrella patensPp1s27_45V6.1Pp1s33_144V6.1Pp1s12_341V6.1Pp1s27_365V6.1Pp1s234_74V6.1
Pp1s404_31V6.1Pp1s404_28V6.1Pp1s104_147V6.1Pp1s104_136V6.1Pp1s302_43V6.1
Pp1s38_153V6.1Pp1s22_124V6.1Pp1s2_195V6.1Pp1s302_51V6.1Pp1s34_269V6.1
Phaseolus vulgarisPhvul.010G119300.1Phvul.001G082500.2Phvul.001G082500.1Phvul.009G052100.1Phvul.008G036600.1
Phvul.004G029100.1Phvul.002G196600.1Phvul.007G232700.1
Picea abiesMA_10429460g0010MA_294189g0010MA_8865271g0010MA_10429460g0020MA_675870g0010
MA_61874g0010MA_99090g0010MA_10430152g0010MA_64002g0010MA_10437241g0010.640.761
MA_10428935g0010MA_10437211g0010
Populus trichocarpaPotri.011G152200.1Potri.001G449500.1Potri.011G152200.2Potri.001G449500.7Potri.001G449500.6
Potri.001G449500.14Potri.001G449500.9Potri.001G449500.8Potri.001G449500.4Potri.001G449500.3
Potri.001G449500.2Potri.001G449500.13Potri.001G449500.12Potri.001G449500.11Potri.001G449500.10
Potri.001G449500.5Potri.017G084100.2Potri.017G084100.1Potri.015G012400.5Potri.015G012400.4
Potri.015G012400.3Potri.015G012400.2Potri.015G012400.1Potri.017G084100.3Potri.015G012400.6
Potri.001G351800.2Potri.001G351800.1Potri.001G351800.3Potri.018G149500.3Potri.018G149500.2
Potri.018G149500.1Potri.007G009600.3Potri.007G009600.2Potri.007G009600.1Potri.007G009600.4
Potri.007G009600.5Potri.007G009600.6
Prunus persicappa002955mppa002995mppa002686mppa001734mppa000758m
ppa001074m.471.914ppa004088mppa002460m
Ricinus communis29866.m00060930068.m002598.200.51230068.m002598.200.51228838.m00025430068.m002598.81.201
30068.m002598.81.20129693.m00205228179.m000474
Setaria italicaSi029257mSi006103mSi006111mSi005900mSi006038m
Si016492mSi034299mSi021148mSi016438mSi016436m
Si006020mSi016717m
Selaginella moellendorffii149847155312815788017692017
154776.453.89577446
Sorghum bicolorSb02g009870.1Sb10g002140.1Sb10g008200.1Sb04g028060.1Sb01g021190.1
Sb10g004160.1Sb10g004160.2Sb09g026570.1Sb04g036590.1
Thellungiella halophilaThhalv10007089mThhalv10020091mThhalv10003782mThhalv10024297mThhalv10006781m.649.811
Thhalv10004081m
Vitis viniferaGSVIVT01027437001GSVIVT01019680001GSVIVT01038557001GSVIVT01011429001GSVIVT01021404001
GSVIVT01032233001GSVIVT01003706001.492.753GSVIVT01003706001.492.753GSVIVT01003706001.55.225GSVIVT01003706001.55.225
Volvox carteriVocar20008500mVocar20008023mVocar20009998mVocar20003880m.572.781Vocar20003880m.572.781
Vocar20003880m.823.964Vocar20003880m.823.964Vocar20010278m.463.655Vocar20010278m.463.655Vocar20001959m
Vocar20006355m.611.741Vocar20006355m.611.741Vocar20006355m.282.456Vocar20006355m.282.456Vocar20010278m.157.458
Vocar20010278m.157.458
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)