y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.010G243800.1
FamilyGH18
Protein PropertiesLength: 411 Molecular Weight: 45426.5 Isoelectric Point: 4.9228
ChromosomeChromosome/Scaffold: 10 Start: 61290970 End: 61292281
DescriptionGlycosyl hydrolase family protein with chitinase insertion domain
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH18693960
  AYWPSFESFPVSSIDTSFFTHIYYAFLLPEPNFFKLNVTSLDQQKLPEFMSGLSAKNPPVKTILSIGGGGNDPNVFAGMASTKCTRAVFINSTIEVARNY
  QFDGIDLDWEFPETVDDMANLALLFEEWSEALQNEAETSWKPRLLLTAAVYYSSEFTTYGVPRSYPARAMAKYLDWMNPMCFDYHGKWDNFTGMHSALFD
  PNTSASSSHGIGSWIRAGVPPGKLVMGLASYGHTWKLQDPNINGIGAPATGVGPGDDPGLFDYYAILDFNKENNATVKYDRTTVSYYSYVGDTWIGYDDV
  KSIKWKVWFARVKGLAGYFFWAVGYDKE
Full Sequence
Protein Sequence     Length: 411     Download
MASLKSTCVL FLAMFCISVT KSEPYFSPGP APEIFPPLPV SYVPTPAPGP TSYPPVPAVS    60
PSPRGIKAAY WPSFESFPVS SIDTSFFTHI YYAFLLPEPN FFKLNVTSLD QQKLPEFMSG    120
LSAKNPPVKT ILSIGGGGND PNVFAGMAST KCTRAVFINS TIEVARNYQF DGIDLDWEFP    180
ETVDDMANLA LLFEEWSEAL QNEAETSWKP RLLLTAAVYY SSEFTTYGVP RSYPARAMAK    240
YLDWMNPMCF DYHGKWDNFT GMHSALFDPN TSASSSHGIG SWIRAGVPPG KLVMGLASYG    300
HTWKLQDPNI NGIGAPATGV GPGDDPGLFD YYAILDFNKE NNATVKYDRT TVSYYSYVGD    360
TWIGYDDVKS IKWKVWFARV KGLAGYFFWA VGYDKEWALS RQGDNILLLA *             420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd06548GH18_chitinase6.0e-5877394352+
pfam00704Glyco_hydro_189.0e-7768394336+
cd02872GH18_chitolectin_chitotriosidase4.0e-8468391342+
smart00636Glyco_182.0e-8967394343+
cd02879GH18_plant_chitinase_class_V4.0e-12266400337+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqXP_002308695.1043405129496predicted protein [Populus trichocarpa]
RefSeqXP_002308697.102640524430predicted protein [Populus trichocarpa]
RefSeqXP_002324562.106340927374predicted protein [Populus trichocarpa]
RefSeqXP_002515448.1064405172512chitinase, putative [Ricinus communis]
RefSeqXP_002523521.106340328370chitinase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3aqu_D0664015337A Chain A, Crystal Structure Of A Class V Chitinase From Arabidopsis Thaliana
PDB3aqu_C0664015337A Chain A, Crystal Structure Of A Class V Chitinase From Arabidopsis Thaliana
PDB3aqu_B0664015337A Chain A, Crystal Structure Of A Class V Chitinase From Arabidopsis Thaliana
PDB3aqu_A0664015337A Chain A, Crystal Structure Of A Class V Chitinase From Arabidopsis Thaliana
PDB3alf_A0644012339A Chain A, Crystal Structure Of Class V Chitinase From Nicotiana Tobaccum
Signal Peptide
Cleavage Site
22
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CA800269255663190
CX661529218642810
DT5075212211854050
CK260093299643590
DV1548332511183660
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_016_00165.1Aquca_019_00180.1Aquca_016_00164.1
Arabidopsis lyrata329582492890492888
Arabidopsis thalianaAT4G19810.1AT4G19800.1AT4G19730.1AT4G19820.1AT4G19760.1
AT4G19750.1AT4G19720.1AT4G19770.1AT4G19740.1
Brachypodium distachyonBradi5g07230.1
Brassica rapaBra020951Bra000892Bra013426
Carica papayaevm.model.supercontig_127.9
Capsella rubellaCarubv10005044mCarubv10005092mCarubv10006448mCarubv10007736mCarubv10007562m
Chlamydomonas reinhardtiig5109.t1Cre13.g570700.t1.3Cre07.g317250.t1.3Cre02.g112400.t1.3
Citrus clementinaCiclev10010729mCiclev10010227mCiclev10008669mCiclev10030182mCiclev10028370m
Ciclev10028151mCiclev10027866mCiclev10007520mCiclev10027910mCiclev10030156m
Ciclev10010726mCiclev10030238mCiclev10010769mCiclev10030037m
Citrus sinensisorange1.1g040415morange1.1g011487morange1.1g037639morange1.1g012216morange1.1g035910m
orange1.1g043488morange1.1g036029morange1.1g012202morange1.1g009209morange1.1g041217m
orange1.1g006211morange1.1g004402morange1.1g040722morange1.1g008332morange1.1g008036m
orange1.1g003932morange1.1g046015morange1.1g041898morange1.1g042934m
Cucumis sativusCucsa.350810.1Cucsa.350800.1Cucsa.350810.2Cucsa.350820.1Cucsa.132610.1
Eucalyptus grandisEucgr.L02946.1Eucgr.C01666.1Eucgr.L00615.1Eucgr.C01980.1Eucgr.C01669.1
Eucgr.C04060.1Eucgr.C01979.1Eucgr.C04051.1Eucgr.C01977.1Eucgr.C01978.1
Eucgr.C00400.1Eucgr.C00393.1Eucgr.C00395.1Eucgr.C00386.1Eucgr.L01120.1
Eucgr.C00398.1Eucgr.C00392.1Eucgr.C00394.1Eucgr.C00396.1Eucgr.C00389.1
Eucgr.C00399.1Eucgr.C00397.1.210.504Eucgr.C00397.1.210.504Eucgr.C00397.1.52.165Eucgr.C00397.1.52.165
Eucgr.C00383.1Eucgr.C00384.1
Fragaria vescamrna15030.1-v1.0-hybridmrna30870.1-v1.0-hybrid.289.616mrna30870.1-v1.0-hybrid.289.616mrna30875.1-v1.0-hybridmrna10038.1-v1.0-hybrid.101.430
mrna10038.1-v1.0-hybrid.101.430mrna10038.1-v1.0-hybrid.101.430mrna30873.1-v1.0-hybridmrna10035.1-v1.0-hybridmrna10037.1-v1.0-hybrid
mrna10038.1-v1.0-hybrid.439.685mrna10038.1-v1.0-hybrid.439.685mrna10038.1-v1.0-hybrid.439.685
Glycine maxGlyma17g33190.1Glyma17g11170.1Glyma13g22350.1Glyma15g25022.1Glyma17g08400.1
Glyma15g25060.1
Gossypium raimondiiGorai.013G217700.1Gorai.001G030000.1Gorai.009G053800.1Gorai.001G030400.1Gorai.001G030200.2
Gorai.001G030200.1Gorai.001G030300.2Gorai.001G030300.1Gorai.009G053900.5Gorai.009G053900.4
Gorai.009G053900.3Gorai.009G053900.1Gorai.001G030100.1Gorai.013G217600.1Gorai.013G217500.1
Gorai.009G053900.2
Linum usitatissimumLus10017124Lus10018329Lus10036311Lus10019060Lus10040021
Lus10036306Lus10019061Lus10036315Lus10036310Lus10041639
Lus10024081
Malus domesticaMDP0000314088MDP0000296520MDP0000513880MDP0000210039MDP0000598998
MDP0000285243MDP0000246155MDP0000260402MDP0000211807MDP0000162506
MDP0000304868MDP0000304618
Manihot esculentacassava4.1_009774mcassava4.1_026732mcassava4.1_031107mcassava4.1_010113mcassava4.1_023806m
Mimulus guttatusmgv1a022475mmgv1a024913m
Oryza sativaLOC_Os11g27400.1LOC_Os04g30770.1
Panicum virgatumPavirv00022804mPavirv00061630mPavirv00036087m
Physcomitrella patensPp1s144_96V6.1Pp1s390_12V6.1Pp1s4666_1V6.1Pp1s2609_1V6.1
Phaseolus vulgarisPhvul.001G046400.1Phvul.003G158800.1Phvul.003G158500.1Phvul.003G158600.1Phvul.003G158700.1
Picea abiesMA_10427204g0010MA_124661g0010MA_126635g0010MA_31969g0010MA_3523814g0010
MA_4925966g0010MA_8321404g0010MA_83505g0010MA_4827640g0010
Populus trichocarpaPotri.018G112000.2Potri.018G112000.1Potri.018G112100.2Potri.018G112100.1Potri.006G261800.1
Potri.006G188300.1Potri.006G188400.1Potri.018G111900.2Potri.018G111900.1Potri.018G111600.2
Potri.018G111600.1Potri.018G111700.1Potri.018G111800.1
Prunus persicappa020347mppa007414mppa019682mppa002009mppa007396m
ppa002019mppa018340mppa017872mppa020647m
Ricinus communis29737.m00123929848.m00456029737.m00123429737.m00123529737.m001238
29737.m001236
Setaria italicaSi026355mSi010200m
Selaginella moellendorffii11003141007141007255473
Sorghum bicolorSb05g012300.1Sb06g011080.1
Thellungiella halophilaThhalv10025464m
Vitis viniferaGSVIVT01001059001GSVIVT01001058001GSVIVT01003718001GSVIVT01001068001GSVIVT01001064001
GSVIVT01001074001GSVIVT01007371001.422.716GSVIVT01007371001.422.716GSVIVT01007371001.116.299GSVIVT01007371001.116.299
GSVIVT01001061001
Volvox carteriVocar20012894m
Zea maysAC211652.4_FGT003
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)