y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.011G050000.1
FamilyGT65
Protein PropertiesLength: 434 Molecular Weight: 49015.9 Isoelectric Point: 8.934
ChromosomeChromosome/Scaffold: 11 Start: 3898177 End: 3899514
DescriptionO-fucosyltransferase family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT65763740
  IAFVRACLTTRMLNRTLLMPSLSASLFCKKINRLQPISFDKVFKFERFNTLCEGFVQLARYSDLKNRTGVYDLRKGSGRKWTVERDLEQLKQSIINGPID
  MHEVIRMVGKNPFLWHGHWPVKDYARVFECLVLVDEISKEADKVVSKIRQIGRKLRSEPGMGSSLRPAPYVAVHIRVEIDWMIHCKKLEQRSGVSQICSS
  KQEIIERVGKIINLEAPIVVYLAVADNLLNDSSLLSGWNKGLVPCEKKNLGVDGIYKKHPYLIQSAIDNEVCSKADIFVGNSFSTFSSHIVFERTQKMM
Full Sequence
Protein Sequence     Length: 434     Download
MDLSSNCKLS RLFACNLTSI ICKCLALVTI ALFFRAILYH LSSGDVLERD DLDLIPGRSM    60
LSQSDEGIRR NKFLEIAFVR ACLTTRMLNR TLLMPSLSAS LFCKKINRLQ PISFDKVFKF    120
ERFNTLCEGF VQLARYSDLK NRTGVYDLRK GSGRKWTVER DLEQLKQSII NGPIDMHEVI    180
RMVGKNPFLW HGHWPVKDYA RVFECLVLVD EISKEADKVV SKIRQIGRKL RSEPGMGSSL    240
RPAPYVAVHI RVEIDWMIHC KKLEQRSGVS QICSSKQEII ERVGKIINLE APIVVYLAVA    300
DNLLNDSSLL SGWNKGLVPC EKKNLGVDGI YKKHPYLIQS AIDNEVCSKA DIFVGNSFST    360
FSSHIVFERT QKMMRMGSTS SCKNENEVDV QWPSYAYNIA AGESNGPQKW MTNMSDSSLR    420
VISYDSNAIS CLG*                                                      480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd11299O-FucT_plant0.001203370180+
cd11298O-FucT-20.0002162369225+
cd11302O-FucT-10.0002195369200+
cd11296O-FucT_like8.0e-20193370182+
pfam10250O-FucT5.0e-2276370326+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_187183.301943116442unknown protein [Arabidopsis thaliana]
RefSeqXP_002273827.10234314427PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002321799.10874311347predicted protein [Populus trichocarpa]
RefSeqXP_002332132.10874311347predicted protein [Populus trichocarpa]
RefSeqXP_002531235.1014311446conserved hypothetical protein [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3zy6_A0.0003244366212340A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB3zy5_A0.0003244366212340A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB3zy4_A0.0003244366212340A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB3zy3_B0.0003244366212340A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB3zy3_A0.0003244366212340A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
Transmembrane Domains
StartEnd
1234
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DW5174702701724310
DW5173972541724150
GO8579223101304310
EL4834502551614150
GO8573533111304310
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_035_00086.1
Arabidopsis lyrata477820
Arabidopsis thalianaAT3G05320.1
Brachypodium distachyonBradi3g05130.1
Brassica rapaBra040646.99.283Bra040646.99.283
Capsella rubellaCarubv10013700mCarubv10013656m
Citrus clementinaCiclev10015216m
Citrus sinensisorange1.1g013043m
Cucumis sativusCucsa.236440.1
Eucalyptus grandisEucgr.H03600.1
Fragaria vescamrna20066.1-v1.0-hybrid
Glycine maxGlyma07g34965.1.189.378Glyma07g34965.1.189.378Glyma07g34965.2.189.378Glyma15g13250.1Glyma20g02800.2
Glyma20g02800.3Glyma09g02350.2Glyma07g34965.2.189.378Glyma09g02350.3Glyma07g34965.3.189.378
Glyma07g34965.3.189.378Glyma07g34965.1.70.189Glyma07g34965.1.70.189Glyma07g34965.2.70.189Glyma07g34965.2.70.189
Glyma07g34965.3.70.189Glyma07g34965.3.70.189
Gossypium raimondiiGorai.009G150500.1.203.398Gorai.011G049800.1Gorai.010G169400.1Gorai.010G169400.2Gorai.009G150500.1.84.201
Gorai.009G150500.1.84.201Gorai.009G150500.1.203.398
Linum usitatissimumLus10018291Lus10040618
Malus domesticaMDP0000794968.202.395MDP0000218405.202.395MDP0000218405.202.395MDP0000794968.202.395MDP0000218405.83.200
MDP0000218405.83.200MDP0000794968.83.200MDP0000794968.83.200MDP0000292513
Manihot esculentacassava4.1_007711m
Medicago truncatulaMedtr4g083590.1Medtr2g028900.1
Mimulus guttatusmgv1a024556m.157.260mgv1a024556m.157.260mgv1a010727m
Oryza sativaLOC_Os02g07200.1LOC_Os02g07200.3LOC_Os02g07200.2
Panicum virgatumPavirv00064034mPavirv00047509m
Phaseolus vulgarisPhvul.006G131800.1.76.195Phvul.006G131600.2Phvul.006G131600.1Phvul.006G131800.1.76.195Phvul.006G131800.1.195.389
Phvul.006G131800.1.195.389
Picea abiesMA_458283g0010MA_730174g0010MA_10435476g0010
Populus trichocarpaPotri.015G117500.1Potri.012G118800.1
Prunus persicappa005601m
Ricinus communis30109.m000167
Setaria italicaSi020158m
Selaginella moellendorffii130392.157.337130392.157.337130392.42.158130392.42.158
Sorghum bicolorSb04g004590.1
Thellungiella halophilaThhalv10020752m.197.381Thhalv10020752m.197.381Thhalv10020752m.78.198Thhalv10020752m.78.198
Vitis viniferaGSVIVT01026258001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny