y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.011G052400.1
FamilyCBM57
Protein PropertiesLength: 862 Molecular Weight: 94703.8 Isoelectric Point: 7.7772
ChromosomeChromosome/Scaffold: 11 Start: 4097390 End: 4104095
DescriptionLeucine-rich repeat transmembrane protein kinase
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM573925543.2e-28
  FAIKCGGPQMTSTGIIFEAENRTLGAATFNVTSTQKWAVSNAGLFADRQDPQFVQNTLAQVKSTNTPELYQTSRLSPGSLRYYGLGLQNGPYTVRLFFAE
  TGFPGRTTQSWKSLARRVFDVYIQGTRRLRDFDISKAAGGVERAIIRNFTANVTENHLEIHLF
Full Sequence
Protein Sequence     Length: 862     Download
MNGEIVRALN SIFQQWDVQA VDSWNTTGDP CSGSALSQDD SVFEDTSNNP AIRCDCSFNA    60
STVCHITRLR VYALDKRGEL LEELLDLPYL TFLKIDQNFF SGPLPAFIGN MSRLGLLSVA    120
HNIFHGSIPQ ELGNLKELYL LSFGNNNFSG TLPPELGSLV KLQQIYINSC GLGGQIPSTF    180
ANLENLEIVW ASDAAFTGKI PDFIGNNWTK LTSLRIEGNS FQGPIPSSFA NLTSLISLRI    240
GGIYNGSSSL NFVRNLKNLT DMVLRNVLLT GTLPSYITEL QSLQKLDLSF NNLTGEIPSA    300
LFTMNSLQYL FLGNNSLSGA IPSQKSESLQ TIDLSYNFLS GNLPSWVNSG LQLNLVANNF    360
TLNSTNIRLL PGLECLQRSF PCNRNAPRYA NFAIKCGGPQ MTSTGIIFEA ENRTLGAATF    420
NVTSTQKWAV SNAGLFADRQ DPQFVQNTLA QVKSTNTPEL YQTSRLSPGS LRYYGLGLQN    480
GPYTVRLFFA ETGFPGRTTQ SWKSLARRVF DVYIQGTRRL RDFDISKAAG GVERAIIRNF    540
TANVTENHLE IHLFWAGKGT CCTPIQGYYG PSISAISVVP NFKPNVSGIP LGIPEEKNHV    600
GLIVGVTVPI VALAFILVFV IIYLKRQRDD DDEELLLGIN PRPNTYSYSE LKAATENFSS    660
SNKLGEGGFG PVYKGTLSDG TVVAVKRLSV ASNQGKEQFV TEIATISAVQ HRNLVKLLGC    720
CIEGKRRLLV YEYLENKSLD QALFGKIDLR LDWPTRFNIC LSTARGLAYL HEESRPRFVR    780
RDVKASNILL DAELCPKISD FGLAKLYDDK KTHVTTRAAG TIGYLAPEYA MRGHLTEKAD    840
VFGFGVVALE ILSGRPNADN T*                                             900
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00180PKc1.0e-45664851192+
cd00192PTKc3.0e-46662853205+
smart00221STYKc2.0e-48663853197+
smart00219TyrKc2.0e-48663853197+
pfam11721Malectin2.0e-52391576190+
Gene Ontology
GO TermDescription
GO:0004672protein kinase activity
GO:0005515protein binding
GO:0005524ATP binding
GO:0006468protein phosphorylation
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI39026.10186143902unnamed protein product [Vitis vinifera]
RefSeqXP_002272404.1068613859PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002273016.10686148904PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002297945.10886146898predicted protein [Populus trichocarpa]
RefSeqXP_002303698.10285915867predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3ulz_A06308597236A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60 Provides Insight Into The Various Cross-Allergenicity Of The Pollen Group 4 Allergens
PDB3uim_A06308597236A Chain A, Structural Basis For The Impact Of Phosphorylation On Plant Receptor- Like Kinase Bak1 Activation
PDB3tl8_H063085915244B Chain B, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector
PDB3tl8_G063085915244B Chain B, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector
PDB3tl8_D063085915244B Chain B, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector
Transmembrane Domains
StartEnd
600622
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GR7079002744447170
ES8116633353406740
DT4660522592935510
FC9274582655978610
ES811663886247110.00000000002
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_030_00368.2Aquca_030_00368.1
Arabidopsis lyrata883240.424.594883240.424.594892639892640892638
Arabidopsis thalianaAT1G56130.1AT1G56140.1AT1G56120.1AT1G56145.2AT1G56145.1
Brachypodium distachyonBradi5g21870.2Bradi5g21857.1Bradi3g17756.2Bradi3g17756.1Bradi1g48230.1
Brassica rapaBra003333Bra007909Bra007908Bra030813Bra030815
Bra033670Bra035966Bra033958Bra007907Bra016226
Carica papayaevm.model.supercontig_2207.1evm.model.supercontig_748.4
Capsella rubellaCarubv10008172mCarubv10012587mCarubv10010895mCarubv10008256mCarubv10008071m.409.563
Carubv10008071m.409.563Carubv10008183m
Citrus clementinaCiclev10007054mCiclev10007687mCiclev10007686mCiclev10018029mCiclev10018038m
Ciclev10014641mCiclev10014117m
Citrus sinensisorange1.1g001658morange1.1g008072morange1.1g006515morange1.1g006206morange1.1g004413m
orange1.1g002562morange1.1g002581morange1.1g038019m
Cucumis sativusCucsa.239700.2Cucsa.239700.1
Eucalyptus grandisEucgr.F04434.2Eucgr.F04434.1Eucgr.F04306.1Eucgr.F04441.1Eucgr.F02391.1
Eucgr.F04436.1Eucgr.C02767.1Eucgr.L01594.1Eucgr.F04301.1Eucgr.L01787.1
Eucgr.B01468.1Eucgr.F04437.1
Fragaria vescamrna11624.1-v1.0-hybridmrna16334.1-v1.0-hybridmrna30033.1-v1.0-hybridmrna28048.1-v1.0-hybrid
Glycine maxGlyma09g15200.3Glyma09g15200.2Glyma09g15200.1Glyma08g25590.2Glyma08g25600.2
Glyma08g25600.1
Gossypium raimondiiGorai.002G105800.1Gorai.001G034000.1Gorai.011G052100.1Gorai.N011200.1Gorai.011G052400.2
Gorai.001G131900.1Gorai.006G091400.1Gorai.011G052300.5Gorai.011G052300.4Gorai.011G052300.3
Gorai.011G052300.2Gorai.011G052300.1Gorai.011G052000.1Gorai.011G052600.8Gorai.011G052600.7
Gorai.011G052600.6Gorai.011G052600.5Gorai.011G052600.4Gorai.011G052600.3Gorai.011G052600.2
Gorai.011G052600.1
Linum usitatissimumLus10031199
Malus domesticaMDP0000210289MDP0000183693.203.372MDP0000183693.203.372MDP0000213902MDP0000251746
MDP0000269684MDP0000267728MDP0000281046MDP0000207688MDP0000183693.772.939
MDP0000183693.772.939MDP0000389758MDP0000278907MDP0000306337MDP0000384033
MDP0000171164MDP0000307776MDP0000212717MDP0000311945MDP0000308237
MDP0000283397MDP0000122720
Manihot esculentacassava4.1_001509mcassava4.1_001407mcassava4.1_025733mcassava4.1_030674m
Mimulus guttatusmgv1a002601mmgv1a018669mmgv1a000612m
Oryza sativaLOC_Os04g22470.1LOC_Os08g10300.1LOC_Os08g10290.1LOC_Os04g52640.3LOC_Os04g52640.2
LOC_Os04g52640.1LOC_Os04g52600.1LOC_Os04g52630.1LOC_Os05g17810.1LOC_Os04g52614.1
LOC_Os08g10330.1LOC_Os05g17604.6LOC_Os05g17604.5LOC_Os05g17604.4LOC_Os05g17604.3
LOC_Os05g17604.2LOC_Os05g17604.1LOC_Os05g16430.1LOC_Os08g10320.3LOC_Os08g10320.2
LOC_Os08g10320.1LOC_Os08g10310.3LOC_Os08g10310.2LOC_Os08g10310.1LOC_Os04g52606.1
LOC_Os05g16930.1LOC_Os06g07130.1LOC_Os04g52590.1LOC_Os08g10250.1LOC_Os05g16824.4
LOC_Os05g16824.3LOC_Os05g16824.2LOC_Os05g16824.1LOC_Os05g16740.1
Panicum virgatumPavirv00010367mPavirv00021132mPavirv00063388mPavirv00039446mPavirv00006527m
Pavirv00041471mPavirv00039639mPavirv00031150mPavirv00014784mPavirv00036213m
Pavirv00070332mPavirv00032467mPavirv00022623mPavirv00048042m
Physcomitrella patensPp1s244_27V6.2
Phaseolus vulgarisPhvul.011G169300.1
Picea abiesMA_170647g0010MA_162469g0010MA_73800g0010MA_8849269g0010MA_18275g0010
MA_17053g0010MA_954053g0010MA_54077g0010MA_10436782g0010MA_404302g0010
MA_461914g0010
Populus trichocarpaPotri.006G255100.2Potri.018G026800.2Potri.018G026800.1Potri.006G255100.1Potri.001G082900.5
Potri.001G082900.4Potri.001G082900.3Potri.001G082900.2Potri.001G082900.1Potri.003G148000.3
Potri.003G148000.2Potri.003G148000.1Potri.007G067900.3Potri.007G067900.2Potri.007G067900.1
Prunus persicappa017326mppa017049mppa001211mppa001152mppa000802m
ppa015982mppa026535m
Ricinus communis29848.m00461730169.m00632829497.m00008929624.m000325
Setaria italicaSi013203mSi013191mSi013178mSi009240mSi012655m
Si009468mSi009463mSi009322mSi028769mSi028790m
Si009325mSi009466mSi009259mSi006097m
Selaginella moellendorffii438852
Sorghum bicolorSb07g005820.1Sb06g028570.1Sb06g028560.1Sb10g004730.1
Thellungiella halophilaThhalv10012006mThhalv10018064mThhalv10011215mThhalv10016280mThhalv10016175m
Thhalv10019658mThhalv10012222m
Vitis viniferaGSVIVT01037993001.434.602GSVIVT01037993001.434.602GSVIVT01035865001GSVIVT01013621001GSVIVT01029720001.503.674
GSVIVT01029720001.503.674GSVIVT01037982001GSVIVT01038011001GSVIVT01013608001GSVIVT01013612001
GSVIVT01029718001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)