y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.011G054400.1
FamilyGT68
Protein PropertiesLength: 542 Molecular Weight: 61883.9 Isoelectric Point: 7.8501
ChromosomeChromosome/Scaffold: 11 Start: 4293134 End: 4295937
DescriptionO-fucosyltransferase family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT682225160
  NRALVIPSSRFDYQYNRVLDIEHINDCIGKKVVVPFEDFMKLKKNHAHIDKFICYFSTPQPCYMDEEHLKKLKSLGISMGKLEAAWKNEDVKNPSRKTVK
  DVEEKFGSDDDVIAIGDVYFADVERDWVLQPGGPIAHKCKTLIEPSKLILLTAERFIQTFLGSNFIALHFRRHGFLKFCNAKKPSCFYPIPQAADCITRI
  VERANSPVIYLSTDAAGSETGLLQSMIMLNGKTIPLVKRPPRNSAEKWDALLYRHGLEGDSQVEAMLDKTICAMASVFIGASGSTFTEDILRLRK
Full Sequence
Protein Sequence     Length: 542     Download
MDRDSSDEDD DRRNLTYRND TTRSSFNVEE LEPQMRRRSK LTFHKGYLFA LVLPLLIVFI    60
YFSTDIRSLF TSDISSFKFN TVSDQIRESQ LQALHLLNQQ QSSLLSIWNH TFINSNNITT    120
VQFDDIKATL LTQITLNKHM QQILLSPYKA GDTLQNGTAL DPSSAGYGFH RCRKVDQKFS    180
ERRTIEWKPR RNKFLFAICL SGQMSNHLIC LEKHMFFAAI LNRALVIPSS RFDYQYNRVL    240
DIEHINDCIG KKVVVPFEDF MKLKKNHAHI DKFICYFSTP QPCYMDEEHL KKLKSLGISM    300
GKLEAAWKNE DVKNPSRKTV KDVEEKFGSD DDVIAIGDVY FADVERDWVL QPGGPIAHKC    360
KTLIEPSKLI LLTAERFIQT FLGSNFIALH FRRHGFLKFC NAKKPSCFYP IPQAADCITR    420
IVERANSPVI YLSTDAAGSE TGLLQSMIML NGKTIPLVKR PPRNSAEKWD ALLYRHGLEG    480
DSQVEAMLDK TICAMASVFI GASGSTFTED ILRLRKDWGT ASICDEYLCQ GENPNFISGE    540
E*                                                                   600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd11548NodZ_like0.005361516156+
cd11296O-FucT_like0.000219422835+
pfam10250O-FucT9.0e-7217508326+
cd11298O-FucT-22.0e-8382508127+
cd11296O-FucT_like1.0e-17357515169+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAM66093.1015411566unknown [Arabidopsis thaliana]
RefSeqNP_173170.2015411564unknown protein [Arabidopsis thaliana]
RefSeqNP_199853.1015411566unknown protein [Arabidopsis thaliana]
RefSeqXP_002264087.1015411559PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002303337.1015411527predicted protein [Populus trichocarpa]
Transmembrane Domains
StartEnd
4663
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO0852392872385240
ES8502683401825190
ES8269822931824730
CO0817712752505240
ES850268574885410.46
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_013_00900.1Aquca_013_00900.2
Arabidopsis lyrata918074889130474511
Arabidopsis thalianaAT5G50420.1AT1G17270.1AT1G53770.2AT1G53770.1
Brachypodium distachyonBradi1g23980.1
Brassica rapaBra039691Bra016609Bra022515
Carica papayaevm.model.supercontig_25.202
Capsella rubellaCarubv10008736mCarubv10026161mCarubv10008696m
Citrus clementinaCiclev10025289m
Citrus sinensisorange1.1g008526m
Cucumis sativusCucsa.088930.1Cucsa.149140.2Cucsa.088930.2Cucsa.149140.1
Eucalyptus grandisEucgr.J02587.1Eucgr.I02168.1
Fragaria vescamrna05486.1-v1.0-hybrid
Glycine maxGlyma16g01730.1Glyma07g05200.1
Gossypium raimondiiGorai.010G172800.1Gorai.006G090800.1
Linum usitatissimumLus10037461Lus10003929
Malus domesticaMDP0000692823MDP0000881647MDP0000203531
Manihot esculentacassava4.1_004684m
Medicago truncatulaMedtr8g023490.1
Mimulus guttatusmgv1a003863m
Oryza sativaLOC_Os07g38490.1
Panicum virgatumPavirv00005372mPavirv00007596m
Physcomitrella patensPp1s149_19V6.1
Phaseolus vulgarisPhvul.010G122400.1Phvul.009G261000.1
Picea abiesMA_10437033g0010
Populus trichocarpaPotri.003G073500.5Potri.003G073500.1Potri.003G073500.2Potri.003G073500.3Potri.003G073500.4
Potri.003G073500.6
Prunus persicappa004150m
Ricinus communis29884.m000188
Setaria italicaSi029376m
Selaginella moellendorffii146424410382
Sorghum bicolorSb02g037060.1
Thellungiella halophilaThhalv10013133mThhalv10007186mThhalv10011359m
Vitis viniferaGSVIVT01016658001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny