y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.011G147600.1
FamilyCBM20
Protein PropertiesLength: 1187 Molecular Weight: 130500 Isoelectric Point: 6.1961
ChromosomeChromosome/Scaffold: 11 Start: 24011599 End: 24023751
Descriptioncatalytics;carbohydrate kinases;phosphoglucan, water dikinases
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM20851642.4e-21
  NICLDHQVQFGEHVVILGSTKELGSWKKQVPMNWSEDGWICDLELKGGESVEFKFVVVSKDKSVAWEGGNNRVLKLPQGG
Full Sequence
Protein Sequence     Length: 1187     Download
MDSISLRSLH FQIPARKQLK FLPDAAIFSP RISFPFPFPP RINRHHKHSH SLVFAVSSTP    60
TREEEKKKKR TKVKPKSGSG KVGLNICLDH QVQFGEHVVI LGSTKELGSW KKQVPMNWSE    120
DGWICDLELK GGESVEFKFV VVSKDKSVAW EGGNNRVLKL PQGGSFGMIC HWNSTEETLE    180
LLPLSSEEYD DSVDDAGHSE STSTTDALEV EASPFVGQWQ GRPASFMRSN EHHNRELERR    240
WDTTGLEGLA LKLVEGDKSA RNWWRKLEVV RELLVGSLQS EERLEALICS AIYLKWINTG    300
QIPCFEDGGH HRPNRHAEIS RLIFRELERI SSRKDSSPQE LLVIRKIHPC LPSFKAEFTA    360
SVPLTRIRDI AHRNDIPHDL KQEIKHTIQN KLHRNAGPED LVATEAMLAR ITRDPGQYSE    420
AFVEQFKIFH LELKDFFNAG SLTEQLESIR ESLDERGIAA LVMFLECKKS LDAAEGSSSI    480
LDLIKTMRSL GALREVIVRG LESGLRNDAP DAAIAMRQKW RLCEIGLEDY SFVLLSRLLN    540
MLEAVGGANW FADNLESKNI SSWNDPLGAL IVGVHQLSLS GWKPEECAAI QNELTAWQEK    600
GLFAKEGSED GKRIWALRLK ATLDRSRRLT EEYSEVLLQL FPQKVQMLGK ALGIPENSIR    660
TYAEAEIRAG VIFQVSKLCS LLLKAVRTAL GSEGWDVLVP GVVSGTLVQV ENIVPGSLPS    720
SLEGPVILVV NKADGDEEVT AAGSNIAGVV LLQELPHLSH LGVRARQEKV IFVTCEDEEK    780
VSYIQKLEGK CVRLEASSSG VSISPSSLDD RDADSVAKNL STNGSSAVYM RGPPDLTGLS    840
PKASYSNKGS SSAGLILLAD ADAQTSGAKA AACGRLASLA AVSDKVYSDL GVPASFRVPA    900
GVVIPFGSME WALEQNKSME TFMSLREKIE TARLEDGELD NLCHQLQQLV SSVQPPQDLI    960
DSIMRVFPGN VRLIVRSSAN VEDLAGMSAA GLYESIPNVS PSNPTVFASA VSQVWASLYT    1020
RRAVLSRRAA GVSQKDATMA VLVQEMLAPD LSFVLHTLSP TDHDHNYVEA EIAPGLGETL    1080
ASGTRGTPWR LSSGKFDGLV KTVAFANFSE EMVVSGASPA DGEVIRLTVD YSKKPLTVDP    1140
VFRQQLSQRL SAVGFFLERK FGCPQDVEGC VLGKDIYVVQ TRPQPL*                  1200
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG0574PpsA2.0e-168941183306+
TIGR01418PEP_synth2.0e-218921184312+
PRK06241PRK062415.0e-348941183299+
cd05818CBM20_water_dikinase1.0e-398417289+
pfam01326PPDK_N6.0e-528941184294+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0005524ATP binding
GO:0005975carbohydrate metabolic process
GO:0016301kinase activity
GO:0016310phosphorylation
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAU93516.10411186331196chloroplast alpha-glucan water dikinase isoform 3 [Arabidopsis thaliana]
EMBLCBI39424.101118511148unnamed protein product [Vitis vinifera]
RefSeqNP_198009.30411186331196ATGWD3; carbohydrate kinase/ catalytic/ phosphoglucan, water dikinase [Arabidopsis thaliana]
RefSeqXP_002265211.101118511187PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002518612.105118531174chloroplast alpha-glucan water dikinase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1kum_A0.000000282163795A Chain A, The Crystal Structure Of The Phosphoenolpyruvate Synthase From Neisseria Meningitidis
PDB1kul_A0.000000282163795A Chain A, The Crystal Structure Of The Phosphoenolpyruvate Synthase From Neisseria Meningitidis
PDB1acz_A0.000000282163795A Chain A, Glucoamylase, Granular Starch-Binding Domain Complex With Cyclodextrin, Nmr, 5 Structures
PDB1ac0_A0.000000282163795A Chain A, Glucoamylase, Granular Starch-Binding Domain Complex With Cyclodextrin, Nmr, Minimized Average Structure
PDB2ols_A0.0000004862118616338A Chain A, The Crystal Structure Of The Phosphoenolpyruvate Synthase From Neisseria Meningitidis
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO77800088831811870
HO79474573546311870
CO07671229785511510
ES79673631778010960
HO794745454254690.0000000000005
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_045_00042.3Aquca_045_00042.2Aquca_045_00042.1Aquca_009_00054.3.18.103
Arabidopsis lyrata486949489476
Arabidopsis thalianaAT5G01260.2AT5G01260.1AT5G26570.2AT5G26570.1
Brachypodium distachyonBradi2g55380.3Bradi2g55380.2Bradi2g55380.1
Brassica rapaBra005693
Carica papayaevm.model.supercontig_112.34evm.model.supercontig_163.14
Capsella rubellaCarubv10001501mCarubv10001111mCarubv10000070m
Chlamydomonas reinhardtiiCre17.g719900.t1.2Cre17.g703000.t1.3Cre06.g269650.t1.2Cre12.g551200.t1.2g10103.t1
Cre02.g091750.t2.1Cre02.g091750.t1.2Cre02.g091750.t3.1Cre12.g492750.t1.3.499.578Cre12.g492750.t1.3.499.578
Cre09.g415600.t2.1Cre09.g415600.t1.3Cre12.g492750.t1.3.218.305Cre12.g492750.t1.3.218.305Cre10.g450500.t1.2
Citrus clementinaCiclev10011625mCiclev10011624mCiclev10011524mCiclev10011409mCiclev10005295m
Ciclev10005277mCiclev10004968mCiclev10010989m.24.109
Citrus sinensisorange1.1g012444morange1.1g012471morange1.1g015140morange1.1g002052m.24.109orange1.1g002050m.24.109
orange1.1g002027m.24.109
Cucumis sativusCucsa.176290.3Cucsa.176290.1
Eucalyptus grandisEucgr.K02988.2Eucgr.K02988.1Eucgr.K01679.1.16.104
Fragaria vescamrna18850.1-v1.0-hybrid
Glycine maxGlyma03g08980.1Glyma07g17931.1Glyma03g08820.1Glyma03g08930.1Glyma18g42781.1
Glyma03g08910.2Glyma1061s50.2Glyma1061s50.1Glyma03g08850.2Glyma03g08850.1
Glyma0165s00200.1Glyma01g28520.2Glyma01g28520.1Glyma03g08860.1Glyma03g08893.1
Glyma19g30580.1.16.102Glyma03g27600.1.16.103
Gossypium raimondiiGorai.006G181700.3Gorai.006G181700.2Gorai.006G181700.1Gorai.007G379100.3Gorai.007G379100.2
Gorai.007G379100.1Gorai.011G147600.3Gorai.011G147600.2Gorai.010G128900.7.16.102Gorai.010G128900.6.16.102
Linum usitatissimumLus10004826Lus10002495Lus10027767Lus10035528Lus10018226
Lus10041275Lus10031010.16.103Lus10035408.16.103
Malus domesticaMDP0000179937MDP0000520902MDP0000218204MDP0000256086MDP0000293128
MDP0000162900MDP0000149290.20.108
Manihot esculentacassava4.1_014927mcassava4.1_029798mcassava4.1_001086m.16.100
Medicago truncatulaMedtr4g015550.1Medtr7g088740.1.16.104
Mimulus guttatusmgv1a007499mmgv1a000923m.17.105
Oryza sativaLOC_Os01g63810.2LOC_Os01g63810.1LOC_Os05g37450.1LOC_Os07g46790.1.13.101
Panicum virgatumPavirv00009276mPavirv00009275mPavirv00011172mPavirv00049022mPavirv00069370m.17.104
Pavirv00069369m.17.104Pavirv00069371m.17.105
Physcomitrella patensPp1s127_37V6.1Pp1s103_94V6.2Pp1s103_94V6.1Pp1s49_209V6.2Pp1s49_209V6.1
Phaseolus vulgarisPhvul.010G002900.1Phvul.008G105500.1Phvul.001G117500.1
Picea abiesMA_10436655g0010
Populus trichocarpaPotri.009G044800.2Potri.009G044800.1Potri.016G114500.7Potri.016G114500.4Potri.016G114500.3
Potri.016G114500.2Potri.016G114500.1Potri.006G099200.3Potri.006G099200.2Potri.006G099200.1
Prunus persicappa007150mppa020714mppa000429mppa000782m.16.104
Ricinus communis29681.m00133229701.m00061530045.m000475.16.104
Setaria italicaSi002103mSi022447mSi028900m.11.98Si028839m.11.98Si034110m.17.104
Selaginella moellendorffii438530415024440606
Sorghum bicolorSb03g040350.1Sb09g021950.1Sb02g042100.1.13.100
Thellungiella halophilaThhalv10014134mThhalv10013736mThhalv10003634m
Vitis viniferaGSVIVT01033976001GSVIVT01025810001.16.103
Volvox carteriVocar20005575mVocar20005574mVocar20000733mVocar20001112mVocar20009467m
Vocar20004703m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)