y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.011G150500.3
FamilyGT41
Protein PropertiesLength: 894 Molecular Weight: 100243 Isoelectric Point: 6.657
ChromosomeChromosome/Scaffold: 11 Start: 25229400 End: 25242808
DescriptionTetratricopeptide repeat (TPR)-like superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT414807720
  RPAMAEAHANLASAYKDSGHVEAAINSYKQALVLRPDFPEATCNLLHTLQCVCDWEDRENKFLEVEGILRRQIKVHAQSATSVIPSVQPFHAIAYPIDPM
  LALEISRKYAAHSSVVASRYSLPPFTYPAPFPGENGNRRLRVGYVSSDFGNHPLSHLMGSVFGMHNRENVEVFSYALSPNDGTEWRLRIQSEAEHFIDVS
  SMSSDMIAKMINEDKIQILVNLNGYTKGARNEIFAMQPAPIQISYMGFPGTTGASYIHYLVTDEFVSPLRFSHIYSEKLVHLPHCYFVNDYKQ
Full Sequence
Protein Sequence     Length: 894     Download
MLSLQSDPRL QQYHHNKLFQ QQQQQVQLFP YNHDSSSLNS DFGGAVAAPA PASSSSSAAA    60
AALSNVKLSD PNEVDDNTLM ALAHQNYKAG NYKQALEHSS VVYERNPCRT DNLLLLGAIH    120
YQLHDYDQCI TKNEEALRID PHFAECYGNM ANAWKEKGNI DTAIQYYLFA IELQPNFADA    180
WSNLASAYMR KGRLNEAAQC CRQALALNPR LVDAHSNLGN LMKIQGFVKE AYNCYLEALR    240
IQPNFAIAWS NLAGLFMEAG DLNRALQYYK EAVRLKPAFF DAYLNLGNVY KALGMPKEAI    300
VCYQRALQVQ PDYAMAYGNL ASVYFEQRNL DMAILNYRRA IAFDSGFLEA YNNLGNALKD    360
AGKVDEAMQC YRQCLALQPN HPQALTNLGN IYMEWNMLSA AASCYKATLS VTTGLSAPFN    420
NLAIIYKQQG NLADAISCYN EVLRIDPMAA DALVNRGNTY KESGRVNEAI HDYIRAINIR    480
PAMAEAHANL ASAYKDSGHV EAAINSYKQA LVLRPDFPEA TCNLLHTLQC VCDWEDRENK    540
FLEVEGILRR QIKVHAQSAT SVIPSVQPFH AIAYPIDPML ALEISRKYAA HSSVVASRYS    600
LPPFTYPAPF PGENGNRRLR VGYVSSDFGN HPLSHLMGSV FGMHNRENVE VFSYALSPND    660
GTEWRLRIQS EAEHFIDVSS MSSDMIAKMI NEDKIQILVN LNGYTKGARN EIFAMQPAPI    720
QISYMGFPGT TGASYIHYLV TDEFVSPLRF SHIYSEKLVH LPHCYFVNDY KQKNLDVLDP    780
NGLPKRSDYG LPEDKFLFAC FNQLYKMDPD IFTTWCNILK RVPNSALWLL RFPAAGETRL    840
RAYATQQGVQ PDQIIFTDVA MKSEHIRRSA LADLFLDTHR CSMGWSSNGD SST*          900
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam13844Glyco_transf_416.0e-38780881104+
pfam13844Glyco_transf_411.0e-68619772155+
COG3914Spy2.0e-72420878470+
Gene Ontology
GO TermDescription
GO:0005515protein binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_187074.106789044862SEC (secret agent); transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqXP_002270163.1018822864PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002319130.10758821804predicted protein [Populus trichocarpa]
RefSeqXP_002453843.107488285889hypothetical protein SORBIDRAFT_04g019560 [Sorghum bicolor]
RefSeqXP_002522031.107288251857o-linked n-acetylglucosamine transferase, ogt, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4gz6_D03797706390A Chain A, Glu381ser Mutant Of Maize Cytokinin OxidaseDEHYDROGENASE COMPLEXED With N6-Isopentenyladenosine
PDB4gz6_D1e-282093696169A Chain A, Glu381ser Mutant Of Maize Cytokinin OxidaseDEHYDROGENASE COMPLEXED With N6-Isopentenyladenosine
PDB4gz6_D2e-28786882514610A Chain A, Glu381ser Mutant Of Maize Cytokinin OxidaseDEHYDROGENASE COMPLEXED With N6-Isopentenyladenosine
PDB4gz6_D3e-271412886153A Chain A, Glu381ser Mutant Of Maize Cytokinin OxidaseDEHYDROGENASE COMPLEXED With N6-Isopentenyladenosine
PDB4gz6_D2e-261753216152A Chain A, Glu381ser Mutant Of Maize Cytokinin OxidaseDEHYDROGENASE COMPLEXED With N6-Isopentenyladenosine
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO798232414704830
HO7982323671495150
HO7982322732525241e-39
HO7982322862515364e-39
HO7982321264225470.000000004
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_058_00216.4.161.321Aquca_058_00216.4.161.321Aquca_058_00216.3.387.547Aquca_058_00216.3.387.547Aquca_058_00216.2
Aquca_058_00216.1.601.761Aquca_058_00216.1.601.761Aquca_072_00077.2Aquca_072_00077.3Aquca_072_00077.1
Arabidopsis lyrata896453.457.745896453.457.745478494
Arabidopsis thalianaAT3G04240.1.457.745AT3G04240.1.457.745AT3G11540.1AT3G11540.2
Brachypodium distachyonBradi3g43577.3.610.769Bradi3g43577.3.610.769Bradi3g43577.2Bradi3g43577.1Bradi5g06647.1.621.781
Bradi5g06647.1.621.781Bradi2g58616.1.592.750Bradi2g58616.1.592.750Bradi3g42910.1
Brassica rapaBra040144.586.743Bra040144.586.743Bra001408Bra034832
Carica papayaevm.model.supercontig_51.46.234.522evm.model.supercontig_51.46.234.522
Capsella rubellaCarubv10012900m.457.745Carubv10012900m.457.745Carubv10013012mCarubv10012928m
Chlamydomonas reinhardtiig13482.t1
Citrus clementinaCiclev10018711m.453.741Ciclev10018711m.453.741Ciclev10011210mCiclev10011021m
Citrus sinensisorange1.1g003557m.291.579orange1.1g003557m.291.579orange1.1g002729m.402.690orange1.1g002729m.402.690orange1.1g002431m.402.690
orange1.1g002431m.402.690orange1.1g005626morange1.1g005594morange1.1g004753morange1.1g007075m
orange1.1g002273morange1.1g003891morange1.1g002443morange1.1g002441morange1.1g002438m
orange1.1g006937morange1.1g007634m
Cucumis sativusCucsa.027630.1.563.753Cucsa.027630.1.563.753Cucsa.083560.1
Eucalyptus grandisEucgr.L00641.1.550.718Eucgr.L00641.1.550.718Eucgr.K02568.1
Fragaria vescamrna16720.1-v1.0-hybrid.551.739mrna16720.1-v1.0-hybrid.551.739mrna15637.1-v1.0-hybrid
Glycine maxGlyma10g31190.2Glyma10g31190.1.468.756Glyma10g31190.1.468.756Glyma20g36330.1.468.756Glyma20g36330.1.468.756
Glyma20g36330.2Glyma19g38241.2Glyma19g38241.1Glyma03g35610.3Glyma03g35610.2
Glyma02g36210.4Glyma02g36210.3Glyma10g08710.1
Gossypium raimondiiGorai.011G150500.2.480.766Gorai.011G150500.2.480.766Gorai.011G150500.1.481.772Gorai.011G150500.1.481.772Gorai.013G189100.3.376.564
Gorai.013G189100.3.376.564Gorai.013G189100.2.571.758Gorai.013G189100.2.571.758Gorai.013G189100.1.571.758Gorai.013G189100.1.571.758
Gorai.011G150500.5.520.693Gorai.011G150500.5.520.693Gorai.011G150500.4.520.693Gorai.011G150500.4.520.693Gorai.007G367900.2
Gorai.007G367900.1Gorai.002G238200.2Gorai.002G238200.1
Linum usitatissimumLus10003576.450.737Lus10003576.450.737Lus10004779.456.744Lus10004779.456.744Lus10003113.456.744
Lus10003113.456.744Lus10021336Lus10017009
Malus domesticaMDP0000233292.459.747MDP0000233292.459.747MDP0000119499MDP0000212192MDP0000846748
Manihot esculentacassava4.1_001015m.583.740cassava4.1_001015m.583.740cassava4.1_002695m.313.473cassava4.1_002695m.313.473cassava4.1_002691m.313.473
cassava4.1_002691m.313.473cassava4.1_001021m.581.740cassava4.1_001021m.581.740cassava4.1_001222mcassava4.1_001239m
cassava4.1_001390m
Medicago truncatulaMedtr1g079510.2.224.512Medtr1g079510.2.224.512Medtr1g079510.1.466.754Medtr1g079510.1.466.754
Mimulus guttatusmgv1a000777m.468.756mgv1a000777m.468.756mgv1a000982m.534.691mgv1a000982m.534.691mgv1a000971m
Oryza sativaLOC_Os01g68680.1.495.747LOC_Os01g68680.1.495.747LOC_Os02g28830.1.255.415LOC_Os02g28830.1.255.415LOC_Os08g44510.1
Panicum virgatumPavirv00063187m.616.777Pavirv00063187m.616.777Pavirv00007611mPavirv00052192m
Physcomitrella patensPp1s263_4V6.1.478.766Pp1s263_4V6.1.478.766Pp1s177_132V6.1.476.764Pp1s177_132V6.1.476.764Pp1s346_18V6.1
Pp1s456_4V6.1Pp1s150_16V6.1
Phaseolus vulgarisPhvul.007G119800.1.469.757Phvul.007G119800.1.469.757Phvul.001G192300.2Phvul.001G192300.1Phvul.007G153100.2
Phvul.007G153100.1
Picea abiesMA_76964g0020.246.533MA_76964g0020.246.533MA_247226g0010.309.469MA_247226g0010.309.469MA_869746g0010
MA_475186g0010MA_261690g0010
Populus trichocarpaPotri.013G051400.7.84.372Potri.013G051400.7.84.372Potri.013G051400.6.224.512Potri.013G051400.6.224.512Potri.013G051400.5
Potri.013G051400.4.463.751Potri.013G051400.4.463.751Potri.013G051400.3.463.751Potri.013G051400.3.463.751Potri.013G051400.2.463.751
Potri.013G051400.2.463.751Potri.013G051400.1.463.751Potri.013G051400.1.463.751Potri.019G025600.5.224.512Potri.019G025600.5.224.512
Potri.019G025600.2.459.747Potri.019G025600.2.459.747Potri.019G025600.1.459.747Potri.019G025600.1.459.747Potri.019G025600.6.213.376
Potri.019G025600.6.213.376Potri.019G025600.4.417.580Potri.019G025600.4.417.580Potri.019G025600.3.478.641Potri.019G025600.3.478.641
Potri.006G208900.1Potri.016G075700.4Potri.016G075700.3Potri.016G075700.1Potri.016G075700.2
Potri.006G208900.3Potri.006G208900.2
Prunus persicappa000862m.459.747ppa000862m.459.747ppa001075m
Ricinus communis29680.m001749.589.74729680.m001749.589.74727556.m00005030032.m00047548742.m000013
Setaria italicaSi016363mSi016197m.619.779Si016197m.619.779Si000265m.480.641Si000265m.480.641
Si013329mSi013225m
Selaginella moellendorffii143846.391.643143846.391.643159012
Sorghum bicolorSb04g019560.1.619.779Sb04g019560.1.619.779Sb07g024110.1
Thellungiella halophilaThhalv10020104mThhalv10020000m.431.719Thhalv10020000m.431.719Thhalv10019996m.457.745Thhalv10019996m.457.745
Thhalv10020052mThhalv10020017m
Vitis viniferaGSVIVT01026359001.593.754GSVIVT01026359001.593.754GSVIVT01033891001
Volvox carteriVocar20006483m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)