y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.011G150500.4
FamilyGT41
Protein PropertiesLength: 923 Molecular Weight: 104021 Isoelectric Point: 6.8774
ChromosomeChromosome/Scaffold: 11 Start: 25229400 End: 25241896
DescriptionTetratricopeptide repeat (TPR)-like superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT415206930
  YSLPPFTYPAPFPGENGNRRLRVGYVSSDFGNHPLSHLMGSVFGMHNRENVEVFSYALSPNDGTEWRLRIQSEAEHFIDVSSMSSDMIAKMINEDKIQIL
  VNLNGYTKGARNEIFAMQPAPIQISYMGFPGTTGASYIHYLVTDEFVSPLRFSHIYSEKLVHLPHCYFVNDYKQ
GT417059130
  PKRSDYGLPEDKFLFACFNQLYKMDPDIFTTWCNILKRVPNSALWLLRFPAAGETRLRAYATQQGVQPDQIIFTDVAMKSEHIRRSALADLFLDTPLCNA
  HTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGVGEEMIVSSLKEYEEKAVSLALNRPKLQELSDKLKAARMTCPLFDTARWVRNLERAYFKMWSVYR
  SGQQPQHIR
Full Sequence
Protein Sequence     Length: 923     Download
MALAHQNYKA GNYKQALEHS SVVYERNPCR TDNLLLLGAI HYQLHDYDQC ITKNEEALRI    60
DPHFAECYGN MANAWKEKGN IDTAIQYYLF AIELQPNFAD AWSNLASAYM RKGRLNEAAQ    120
CCRQALALNP RLVDAHSNLG NLMKIQGFVK EAYNCYLEAL RIQPNFAIAW SNLAGLFMEA    180
GDLNRALQYY KEAVRLKPAF FDAYLNLGNV YKALGMPKEA IVCYQRALQV QPDYAMAYGN    240
LASVYFEQRN LDMAILNYRR AIAFDSGFLE AYNNLGNALK DAGKVDEAMQ CYRQCLALQP    300
NHPQALTNLG NIYMEWNMLS AAASCYKATL SVTTGLSAPF NNLAIIYKQQ GNLADAISCY    360
NEVLRIDPMA ADALVNRGNT YKESGRVNEA IHDYIRAINI RPAMAEAHAN LASAYKDSGH    420
VEAAINSYKQ ALVLRPDFPE ATCNLLHTLQ CVCDWEDREN KFLEVEGILR RQIKVHAQSA    480
TSVIPSVQPF HAIAYPIDPM LALEISRKYA AHSSVVASRY SLPPFTYPAP FPGENGNRRL    540
RVGYVSSDFG NHPLSHLMGS VFGMHNRENV EVFSYALSPN DGTEWRLRIQ SEAEHFIDVS    600
SMSSDMIAKM INEDKIQILV NLNGYTKGAR NEIFAMQPAP IQISYMGFPG TTGASYIHYL    660
VTDEFVSPLR FSHIYSEKLV HLPHCYFVND YKQKNLDVLD PNGLPKRSDY GLPEDKFLFA    720
CFNQLYKMDP DIFTTWCNIL KRVPNSALWL LRFPAAGETR LRAYATQQGV QPDQIIFTDV    780
AMKSEHIRRS ALADLFLDTP LCNAHTTGTD VLWAGLPMVT LPLEKMATRV AGSLCLATGV    840
GEEMIVSSLK EYEEKAVSLA LNRPKLQELS DKLKAARMTC PLFDTARWVR NLERAYFKMW    900
SVYRSGQQPQ HIRVTENDEE FA*                                            960
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam13844Glyco_transf_411.0e-68540693155+
pfam13844Glyco_transf_412.0e-77701900202+
COG3914Spy3.0e-103341905576+
Gene Ontology
GO TermDescription
GO:0005515protein binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_187074.10192157973SEC (secret agent); transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqXP_002270163.10192166982PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002319130.1019216922predicted protein [Populus trichocarpa]
RefSeqXP_002319130.10.0000000022704453178predicted protein [Populus trichocarpa]
RefSeqXP_002522031.10192159975o-linked n-acetylglucosamine transferase, ogt, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4gz6_D03006916390A Chain A, Glu381ser Mutant Of Maize Cytokinin OxidaseDEHYDROGENASE COMPLEXED With N6-Isopentenyladenosine
PDB4gz6_D0707912514718A Chain A, Glu381ser Mutant Of Maize Cytokinin OxidaseDEHYDROGENASE COMPLEXED With N6-Isopentenyladenosine
PDB4gz6_D1e-281302906169A Chain A, Glu381ser Mutant Of Maize Cytokinin OxidaseDEHYDROGENASE COMPLEXED With N6-Isopentenyladenosine
PDB4gz6_D2e-27622096153A Chain A, Glu381ser Mutant Of Maize Cytokinin OxidaseDEHYDROGENASE COMPLEXED With N6-Isopentenyladenosine
PDB4gz6_D1e-26962426152A Chain A, Glu381ser Mutant Of Maize Cytokinin OxidaseDEHYDROGENASE COMPLEXED With N6-Isopentenyladenosine
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7952474614629200
HO7787254414829200
HO79823240414040
HO798232367704360
HO795247514104602e-18
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_058_00216.4.161.321Aquca_058_00216.4.161.321Aquca_058_00216.3.387.547Aquca_058_00216.3.387.547Aquca_058_00216.2
Aquca_058_00216.1.601.761Aquca_058_00216.1.601.761Aquca_072_00077.2Aquca_072_00077.3Aquca_072_00077.1
Arabidopsis lyrata896453.457.745896453.457.745478494
Arabidopsis thalianaAT3G04240.1.457.745AT3G04240.1.457.745AT3G11540.1AT3G11540.2
Brachypodium distachyonBradi3g43577.3.610.769Bradi3g43577.3.610.769Bradi3g43577.2Bradi3g43577.1Bradi5g06647.1.621.781
Bradi5g06647.1.621.781Bradi2g58616.1.592.750Bradi2g58616.1.592.750Bradi3g42910.1
Brassica rapaBra040144.586.743Bra040144.586.743Bra001408Bra034832
Carica papayaevm.model.supercontig_51.46.234.522evm.model.supercontig_51.46.234.522
Capsella rubellaCarubv10012900m.457.745Carubv10012900m.457.745Carubv10013012mCarubv10012928m
Chlamydomonas reinhardtiig13482.t1
Citrus clementinaCiclev10018711m.453.741Ciclev10018711m.453.741Ciclev10011210mCiclev10011021m
Citrus sinensisorange1.1g003557m.291.579orange1.1g003557m.291.579orange1.1g002729m.402.690orange1.1g002729m.402.690orange1.1g002431m.402.690
orange1.1g002431m.402.690orange1.1g005626morange1.1g005594morange1.1g004753morange1.1g007075m
orange1.1g002273morange1.1g003891morange1.1g002443morange1.1g002441morange1.1g002438m
orange1.1g006937morange1.1g007634m
Cucumis sativusCucsa.027630.1.563.753Cucsa.027630.1.563.753Cucsa.083560.1
Eucalyptus grandisEucgr.L00641.1.550.718Eucgr.L00641.1.550.718Eucgr.K02568.1
Fragaria vescamrna16720.1-v1.0-hybrid.551.739mrna16720.1-v1.0-hybrid.551.739mrna15637.1-v1.0-hybrid
Glycine maxGlyma10g31190.2Glyma10g31190.1.468.756Glyma10g31190.1.468.756Glyma20g36330.1.468.756Glyma20g36330.1.468.756
Glyma20g36330.2Glyma19g38241.2Glyma19g38241.1Glyma03g35610.3Glyma03g35610.2
Glyma02g36210.4Glyma02g36210.3Glyma10g08710.1
Gossypium raimondiiGorai.011G150500.2.480.766Gorai.011G150500.2.480.766Gorai.011G150500.1.481.772Gorai.011G150500.1.481.772Gorai.011G150500.3
Gorai.013G189100.3.376.564Gorai.013G189100.3.376.564Gorai.013G189100.2.571.758Gorai.013G189100.2.571.758Gorai.013G189100.1.571.758
Gorai.013G189100.1.571.758Gorai.011G150500.5.520.693Gorai.011G150500.5.520.693Gorai.011G150500.4.520.693Gorai.011G150500.4.520.693
Gorai.007G367900.2Gorai.007G367900.1Gorai.002G238200.2Gorai.002G238200.1
Linum usitatissimumLus10003576.450.737Lus10003576.450.737Lus10004779.456.744Lus10004779.456.744Lus10003113.456.744
Lus10003113.456.744Lus10021336Lus10017009
Malus domesticaMDP0000233292.459.747MDP0000233292.459.747MDP0000119499MDP0000212192MDP0000846748
Manihot esculentacassava4.1_001015m.583.740cassava4.1_001015m.583.740cassava4.1_002695m.313.473cassava4.1_002695m.313.473cassava4.1_002691m.313.473
cassava4.1_002691m.313.473cassava4.1_001021m.581.740cassava4.1_001021m.581.740cassava4.1_001222mcassava4.1_001239m
cassava4.1_001390m
Medicago truncatulaMedtr1g079510.2.224.512Medtr1g079510.2.224.512Medtr1g079510.1.466.754Medtr1g079510.1.466.754
Mimulus guttatusmgv1a000777m.468.756mgv1a000777m.468.756mgv1a000982m.534.691mgv1a000982m.534.691mgv1a000971m
Oryza sativaLOC_Os01g68680.1.495.747LOC_Os01g68680.1.495.747LOC_Os02g28830.1.255.415LOC_Os02g28830.1.255.415LOC_Os08g44510.1
Panicum virgatumPavirv00063187m.616.777Pavirv00063187m.616.777Pavirv00007611mPavirv00052192m
Physcomitrella patensPp1s263_4V6.1.478.766Pp1s263_4V6.1.478.766Pp1s177_132V6.1.476.764Pp1s177_132V6.1.476.764Pp1s346_18V6.1
Pp1s456_4V6.1Pp1s150_16V6.1
Phaseolus vulgarisPhvul.007G119800.1.469.757Phvul.007G119800.1.469.757Phvul.001G192300.2Phvul.001G192300.1Phvul.007G153100.2
Phvul.007G153100.1
Picea abiesMA_76964g0020.246.533MA_76964g0020.246.533MA_247226g0010.309.469MA_247226g0010.309.469MA_869746g0010
MA_475186g0010MA_261690g0010
Populus trichocarpaPotri.013G051400.7.84.372Potri.013G051400.7.84.372Potri.013G051400.6.224.512Potri.013G051400.6.224.512Potri.013G051400.5
Potri.013G051400.4.463.751Potri.013G051400.4.463.751Potri.013G051400.3.463.751Potri.013G051400.3.463.751Potri.013G051400.2.463.751
Potri.013G051400.2.463.751Potri.013G051400.1.463.751Potri.013G051400.1.463.751Potri.019G025600.5.224.512Potri.019G025600.5.224.512
Potri.019G025600.2.459.747Potri.019G025600.2.459.747Potri.019G025600.1.459.747Potri.019G025600.1.459.747Potri.019G025600.6.213.376
Potri.019G025600.6.213.376Potri.019G025600.4.417.580Potri.019G025600.4.417.580Potri.019G025600.3.478.641Potri.019G025600.3.478.641
Potri.006G208900.1Potri.016G075700.4Potri.016G075700.3Potri.016G075700.1Potri.016G075700.2
Potri.006G208900.3Potri.006G208900.2
Prunus persicappa000862m.459.747ppa000862m.459.747ppa001075m
Ricinus communis29680.m001749.589.74729680.m001749.589.74727556.m00005030032.m00047548742.m000013
Setaria italicaSi016363mSi016197m.619.779Si016197m.619.779Si000265m.480.641Si000265m.480.641
Si013329mSi013225m
Selaginella moellendorffii143846.391.643143846.391.643159012
Sorghum bicolorSb04g019560.1.619.779Sb04g019560.1.619.779Sb07g024110.1
Thellungiella halophilaThhalv10020104mThhalv10020000m.431.719Thhalv10020000m.431.719Thhalv10019996m.457.745Thhalv10019996m.457.745
Thhalv10020052mThhalv10020017m
Vitis viniferaGSVIVT01026359001.593.754GSVIVT01026359001.593.754GSVIVT01033891001
Volvox carteriVocar20006483m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)