y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.011G160300.1
FamilyGH116
Protein PropertiesLength: 970 Molecular Weight: 108285 Isoelectric Point: 7.1686
ChromosomeChromosome/Scaffold: 11 Start: 29340605 End: 29352103
DescriptionBeta-glucosidase, GBA2 type family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1165519130
  GRFLYLEGVEYIMWCTYDVHFYASFALLELFPKIELNIQRDFAKAVLSEDGRKVKFLAEGNYGIRKVRGAVPHDLGTHDPWNEMNAYNIHDTSKWKDLNS
  KFVLQVYRDFAATGDMAFGIEVWPAVRTAMEYMEQFDRDDDGLIENDGFPDQTYDAWTVHGVSAYCGCLWLAALQAAAAMAQRLGDKFFAETCKTKFFSA
  KSAFEKKLWNGSYFNYDSGSSSNSKSIQADQLAGQWYTSSSGLGPIFDEFKTRSSLQKIFDFNVMKVKGGRMGAVNGMHPNGKVDESCMQSREVWTGVTY
  AVAANMLLAGMEEEAFTTAEGIFIAGWSEEGFGYWFQTPEGWTTNGHYRSLIYMRPLAIWSMQ
Full Sequence
Protein Sequence     Length: 970     Download
MVTGNLFHSK KNSWPPEEYV SRNTLQLFNF DSAAPPKQAW RRRLNSHANI LKEFSVTFME    60
AIQMVRLGIR LWSYVREEAS HGRKAPIDPF TRESCKPSAS QGVPLGGMGS GSISRGFRGE    120
FRQWQIIPGT CNISPVMANQ FSIFISRDGG NKKYASVLAP GQHEGLGKTS DEGISSWGWN    180
LNGQHSTYHA LFPRAWTIYD GEPDPDLKVS CRQISPFVPH DYRDSSLPTA VFVYTLVNTG    240
KERAKVSLLF TWANSIGGIS HLSGDHVNEP FIGEDGVSGV LLHHKTAKGN PPVTFAVAAS    300
ETQNVNVTVL PCFGLTEGSF ITARKIWGKM MQDGQFDREN FNIGPSMPSS PGETLCAAVS    360
ASAWVEPHGK CTIAFALAWS SPKIKFSKGS SYHRRYTKFY GTSERAAVDL VHDALTNYKH    420
WEEEIEKWQS PILEDIRLPE WYKFTLFNEL YFLVAGGTVW IDSSSPSADV KSDQDPPIKV    480
ESKNIKVAEA EMNCRHSTGF EHTSTSGCNS STGVGLKQNG SSTIPRKKRS CKHFSHHLKT    540
EDQLDGNEDV GRFLYLEGVE YIMWCTYDVH FYASFALLEL FPKIELNIQR DFAKAVLSED    600
GRKVKFLAEG NYGIRKVRGA VPHDLGTHDP WNEMNAYNIH DTSKWKDLNS KFVLQVYRDF    660
AATGDMAFGI EVWPAVRTAM EYMEQFDRDD DGLIENDGFP DQTYDAWTVH GVSAYCGCLW    720
LAALQAAAAM AQRLGDKFFA ETCKTKFFSA KSAFEKKLWN GSYFNYDSGS SSNSKSIQAD    780
QLAGQWYTSS SGLGPIFDEF KTRSSLQKIF DFNVMKVKGG RMGAVNGMHP NGKVDESCMQ    840
SREVWTGVTY AVAANMLLAG MEEEAFTTAE GIFIAGWSEE GFGYWFQTPE GWTTNGHYRS    900
LIYMRPLAIW SMQWVLSPPK AIIEAPKINM MDRIVISPAT FSLSLPETRV RKIANKTACF    960
GNSSLQCTC*                                                           1020
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3408GDB10.001618708100+
COG4354COG43541.0e-29102462367+
COG4354COG43544.0e-58547916389+
pfam12215GBA2_N5.0e-67102421330+
pfam04685DUF6081.0e-146551914367+
Gene Ontology
GO TermDescription
GO:0004348glucosylceramidase activity
GO:0006665sphingolipid metabolic process
GO:0016021integral to membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAB01359.1019691937unnamed protein product [Arabidopsis thaliana]
RefSeqNP_189060.2019691950catalytic/ glucosylceramidase [Arabidopsis thaliana]
RefSeqXP_002285674.1019691978PREDICTED: similar to catalytic [Vitis vinifera]
RefSeqXP_002303825.1019691966predicted protein [Populus trichocarpa]
RefSeqXP_002518119.1019691968conserved hypothetical protein [Ricinus communis]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7798602796939700
HO7798601505456940
HO7798601054165200
GT0454373181174340
GT045437294294570.0002
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00087.2Aquca_017_00087.1Aquca_034_00116.1
Arabidopsis lyrata331392479911473529327181
Arabidopsis thalianaAT1G33700.2AT1G33700.1AT5G49900.1AT3G24180.2AT3G24180.1
AT4G10060.1
Brachypodium distachyonBradi3g28580.1Bradi4g21277.1Bradi3g13487.1Bradi1g28847.1Bradi3g13520.1
Brassica rapaBra014964Bra028008Bra000598Bra028320Bra033199
Carica papayaevm.model.supercontig_59.121evm.model.supercontig_21.79evm.model.supercontig_113.12
Capsella rubellaCarubv10025826mCarubv10012912mCarubv10008221mCarubv10002637m
Citrus clementinaCiclev10004255mCiclev10000199mCiclev10018743mCiclev10018742m
Citrus sinensisorange1.1g039165morange1.1g002202morange1.1g038924m
Cucumis sativusCucsa.266300.2Cucsa.266300.1Cucsa.023010.1Cucsa.237200.1Cucsa.237200.2
Eucalyptus grandisEucgr.I02786.1Eucgr.H02851.2Eucgr.H02851.1Eucgr.H00075.1Eucgr.F02980.1
Eucgr.F02980.2
Fragaria vescamrna29905.1-v1.0-hybridmrna02278.1-v1.0-hybrid
Glycine maxGlyma10g33610.1Glyma20g33990.1Glyma07g40310.2
Gossypium raimondiiGorai.008G046700.1Gorai.011G160300.5Gorai.011G160300.4Gorai.011G160300.3Gorai.011G160300.2
Gorai.013G133800.2Gorai.013G133800.1Gorai.006G221200.3Gorai.006G221200.2Gorai.006G221200.1
Gorai.008G046700.3Gorai.008G046700.2.531.722Gorai.008G046700.2.531.722Gorai.008G046700.2.724.851Gorai.008G046700.2.724.851
Linum usitatissimumLus10000757Lus10003517Lus10002950Lus10023340Lus10038471
Lus10038469
Malus domesticaMDP0000175141MDP0000220028MDP0000128604
Manihot esculentacassava4.1_001108mcassava4.1_002224mcassava4.1_003299mcassava4.1_005809m
Medicago truncatulaMedtr1g072720.1Medtr1g072680.1
Mimulus guttatusmgv1a000876mmgv1a000873m
Oryza sativaLOC_Os10g33420.1LOC_Os11g13810.1LOC_Os08g01940.2LOC_Os08g01940.1LOC_Os07g26210.1
LOC_Os07g26210.2
Panicum virgatumPavirv00047844mPavirv00042892mPavirv00041095mPavirv00002207mPavirv00050055m
Pavirv00014420mPavirv00035631mPavirv00038108m
Physcomitrella patensPp1s134_55V6.1Pp1s40_202V6.1
Phaseolus vulgarisPhvul.007G134300.1Phvul.003G075400.1
Picea abiesMA_10430605g0020MA_10431145g0020MA_61180g0010MA_35878g0010MA_10426003g0020.110.198
MA_10426003g0020.110.198MA_165077g0010
Populus trichocarpaPotri.T163400.1Potri.019G072800.2Potri.019G072800.1Potri.004G227200.4Potri.004G227200.2
Potri.004G227200.1Potri.003G178000.4Potri.003G178000.3Potri.003G178000.2Potri.003G178000.1
Potri.003G003400.1Potri.003G003400.2Potri.019G072800.3Potri.004G227200.3Potri.003G003400.3
Prunus persicappa001012mppa000954m
Ricinus communis29685.m00048429757.m00075229904.m002967
Setaria italicaSi034088mSi026057mSi025923mSi029270mSi028945m
Si028854mSi013210mSi026013m
Selaginella moellendorffii16663492385
Sorghum bicolorSb01g019510.2Sb01g019510.1Sb05g007160.1Sb0073s002050.1Sb07g001140.1
Thellungiella halophilaThhalv10006714mThhalv10012588mThhalv10020003mThhalv10020001m
Vitis viniferaGSVIVT01036381001GSVIVT01023217001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)