y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.011G260700.1
FamilyGT2
Protein PropertiesLength: 334 Molecular Weight: 37765.3 Isoelectric Point: 9.9316
ChromosomeChromosome/Scaffold: 11 Start: 59158047 End: 59161350
DescriptionNucleotide-diphospho-sugar transferases superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT2682633.4e-33
  SLIIPAFNEEHRLPGALNETMNYLKKREAKDKSFSYEVLIVDDGSRDGTKRVAFDFVKKYGVDKVRAILLGKNHGKGEAIRKGMLHSRGELLLMLDADGA
  TKVTDLEKLENQIHAVARKEHRGDSAACDTTFKISDIPIVAFGSRAHLEEKAIATRKWYRNFLMKGFHLVVLLTAGPGIRDTQCGFKMFTRSAARK
Full Sequence
Protein Sequence     Length: 334     Download
MIMEFLFTIL AALISIVALG LVSVIVFEAY RRSLNNAHVD APAIFEDPKS LKQVPCPDIF    60
DPAKKYLSLI IPAFNEEHRL PGALNETMNY LKKREAKDKS FSYEVLIVDD GSRDGTKRVA    120
FDFVKKYGVD KVRAILLGKN HGKGEAIRKG MLHSRGELLL MLDADGATKV TDLEKLENQI    180
HAVARKEHRG DSAACDTTFK ISDIPIVAFG SRAHLEEKAI ATRKWYRNFL MKGFHLVVLL    240
TAGPGIRDTQ CGFKMFTRSA ARKLFTNIRL KRWCFDVELV FLCKWFRIPV LEVSVNWSEI    300
PGSKVNLLSI PNMLWELALM SVGYRTQMWK INS*                                360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd06442DPM1_like7.0e-2069293225+
pfam00535Glycos_transf_27.0e-2268265198+
cd04179DPM_DPG-synthase_like9.0e-4869283215+
PTZ00260PTZ002603.0e-902333341+
cd04188DPG_synthase1.0e-9969304236+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_181493.103133332335glycosyl transferase family 2 protein [Arabidopsis thaliana]
RefSeqXP_002283615.102933330336PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002312095.102933330335predicted protein [Populus trichocarpa]
RefSeqXP_002315224.103033331335predicted protein [Populus trichocarpa]
RefSeqXP_002530857.103133132333Dolichyl-phosphate beta-glucosyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3l7m_D0.00367165493A Chain A, Structure Of The Wall Teichoic Acid Polymerase Tagf, H548a
PDB3l7m_C0.00367165493A Chain A, Structure Of The Wall Teichoic Acid Polymerase Tagf, H548a
PDB3l7m_B0.00367165493A Chain A, Structure Of The Wall Teichoic Acid Polymerase Tagf, H548a
PDB3l7m_A0.00367165493A Chain A, Structure Of The Wall Teichoic Acid Polymerase Tagf, H548a
PDB3l7l_D0.00367165493A Chain A, Structure Of The Wall Teichoic Acid Polymerase Tagf, H548a
Transmembrane Domains
StartEnd
527
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DV712496308163220
ES822435259773340
DV704377293163070
DV711028288163020
FS360006255473000
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_011_00165.2Aquca_011_00165.3Aquca_011_00165.4Aquca_011_00165.1
Arabidopsis lyrata482983
Arabidopsis thalianaAT2G39630.2AT2G39630.1
Brachypodium distachyonBradi1g03660.1
Brassica rapaBra005029Bra000139
Carica papayaevm.model.supercontig_1.403
Capsella rubellaCarubv10023563m
Chlamydomonas reinhardtiiCre16.g652850.t1.2
Citrus clementinaCiclev10032053m
Citrus sinensisorange1.1g027065morange1.1g019818morange1.1g023346m
Cucumis sativusCucsa.010820.1Cucsa.165370.1Cucsa.165370.2Cucsa.165370.3
Eucalyptus grandisEucgr.G02933.1Eucgr.G02933.2Eucgr.G02933.3
Fragaria vescamrna26609.1-v1.0-hybrid
Glycine maxGlyma02g10150.1Glyma18g52810.2Glyma18g52810.1Glyma02g10150.3Glyma02g10150.2
Gossypium raimondiiGorai.011G260700.2Gorai.009G319400.2Gorai.009G319400.4Gorai.011G260700.3Gorai.009G319400.1
Gorai.009G319400.3
Linum usitatissimumLus10005164Lus10001691Lus10023414Lus10040296
Malus domesticaMDP0000274007MDP0000272852
Manihot esculentacassava4.1_011328m
Medicago truncatulaMedtr7g026260.2Medtr7g026260.1
Mimulus guttatusmgv1a025143m
Oryza sativaLOC_Os03g60700.1LOC_Os03g60700.2
Panicum virgatumPavirv00060983mPavirv00063183m
Physcomitrella patensPp1s49_46V6.1Pp1s14_205V6.2Pp1s14_205V6.1Pp1s96_201V6.1
Phaseolus vulgarisPhvul.008G010800.1Phvul.008G010800.2
Picea abiesMA_10347707g0010MA_10428813g0010MA_159008g0490MA_158860g0090
Populus trichocarpaPotri.010G204000.4Potri.010G204000.2Potri.010G204000.1Potri.008G055700.1Potri.010G204000.3
Potri.008G055700.2
Prunus persicappa008313m
Ricinus communis30003.m000334
Setaria italicaSi036396m
Selaginella moellendorffii73379414988101926
Sorghum bicolorSb01g003140.1
Thellungiella halophilaThhalv10016901m
Vitis viniferaGSVIVT01016551001
Volvox carteriVocar20012273m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny