y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.011G260700.2
FamilyGT2
Protein PropertiesLength: 247 Molecular Weight: 28114.9 Isoelectric Point: 10.383
ChromosomeChromosome/Scaffold: 11 Start: 59158100 End: 59161350
DescriptionNucleotide-diphospho-sugar transferases superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT2141761.3e-25
  FSYEVLIVDDGSRDGTKRVAFDFVKKYGVDKVRAILLGKNHGKGEAIRKGMLHSRGELLLMLDADGATKVTDLEKLENQIHAVARKEHRGDSAACDTTFK
  ISDIPIVAFGSRAHLEEKAIATRKWYRNFLMKGFHLVVLLTAGPGIRDTQCGFKMFTRSAARK
Full Sequence
Protein Sequence     Length: 247     Download
MNYLKKREAK DKSFSYEVLI VDDGSRDGTK RVAFDFVKKY GVDKVRAILL GKNHGKGEAI    60
RKGMLHSRGE LLLMLDADGA TKVTDLEKLE NQIHAVARKE HRGDSAACDT TFKISDIPIV    120
AFGSRAHLEE KAIATRKWYR NFLMKGFHLV VLLTAGPGIR DTQCGFKMFT RSAARKLFTN    180
IRLKRWCFDV ELVFLCKWFR IPVLEVSVNW SEIPGSKVNL LSIPNMLWEL ALMSVGYRTQ    240
MWKINS*                                                              300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd06442DPM1_like2.0e-1712206195+
pfam00535Glycos_transf_22.0e-1716178163+
cd04179DPM_DPG-synthase_like7.0e-437196190+
PTZ00260PTZ002601.0e-773246248+
cd04188DPG_synthase1.0e-881217217+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN83698.101724621251hypothetical protein [Vitis vinifera]
RefSeqXP_002283615.10124690336PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002312095.10124689335predicted protein [Populus trichocarpa]
RefSeqXP_002315224.10124689335predicted protein [Populus trichocarpa]
RefSeqXP_002530857.10124489333Dolichyl-phosphate beta-glucosyltransferase, putative [Ricinus communis]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
ES82243524812470
CO102034268172460
DV12548723512350
DV71249623612350
EH68885924612460
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_011_00165.2Aquca_011_00165.3Aquca_011_00165.4Aquca_011_00165.1
Arabidopsis lyrata482983
Arabidopsis thalianaAT2G39630.2AT2G39630.1
Brachypodium distachyonBradi1g03660.1
Brassica rapaBra005029Bra000139
Carica papayaevm.model.supercontig_1.403
Capsella rubellaCarubv10023563m
Chlamydomonas reinhardtiiCre16.g652850.t1.2
Citrus clementinaCiclev10032053m
Citrus sinensisorange1.1g027065morange1.1g019818morange1.1g023346m
Cucumis sativusCucsa.010820.1Cucsa.165370.1Cucsa.165370.2Cucsa.165370.3
Eucalyptus grandisEucgr.G02933.1Eucgr.G02933.2Eucgr.G02933.3
Fragaria vescamrna26609.1-v1.0-hybrid
Glycine maxGlyma02g10150.1Glyma18g52810.2Glyma18g52810.1Glyma02g10150.3Glyma02g10150.2
Gossypium raimondiiGorai.009G319400.2Gorai.009G319400.4Gorai.011G260700.3Gorai.011G260700.1Gorai.009G319400.1
Gorai.009G319400.3
Linum usitatissimumLus10005164Lus10001691Lus10023414Lus10040296
Malus domesticaMDP0000274007MDP0000272852
Manihot esculentacassava4.1_011328m
Medicago truncatulaMedtr7g026260.2Medtr7g026260.1
Mimulus guttatusmgv1a025143m
Oryza sativaLOC_Os03g60700.1LOC_Os03g60700.2
Panicum virgatumPavirv00060983mPavirv00063183m
Physcomitrella patensPp1s49_46V6.1Pp1s14_205V6.2Pp1s14_205V6.1Pp1s96_201V6.1
Phaseolus vulgarisPhvul.008G010800.1Phvul.008G010800.2
Picea abiesMA_10347707g0010MA_10428813g0010MA_159008g0490MA_158860g0090
Populus trichocarpaPotri.010G204000.4Potri.010G204000.2Potri.010G204000.1Potri.008G055700.1Potri.010G204000.3
Potri.008G055700.2
Prunus persicappa008313m
Ricinus communis30003.m000334
Setaria italicaSi036396m
Selaginella moellendorffii73379414988101926
Sorghum bicolorSb01g003140.1
Thellungiella halophilaThhalv10016901m
Vitis viniferaGSVIVT01016551001
Volvox carteriVocar20012273m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny