Basic Information | |
---|---|
Species | Gossypium raimondii |
Cazyme ID | Gorai.011G260900.1 |
Family | CBM43 |
Protein Properties | Length: 110 Molecular Weight: 11553.2 Isoelectric Point: 8.0995 |
Chromosome | Chromosome/Scaffold: 11 Start: 59184449 End: 59186198 |
Description | glycosyl hydrolase family 17 protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 26 | 106 | 2.3e-32 |
CVPKPEATDAQLQNNLDYACGQGIDCRPIQAGGVCVEPATVRSRAAFAMNSYFKSKLGVDSACDFGGTGQLTTVDPSYGNC |
Full Sequence |
---|
Protein Sequence Length: 110 Download |
MKPGQPLPKP VQPMPSPPAD NAKKFCVPKP EATDAQLQNN LDYACGQGID CRPIQAGGVC 60 VEPATVRSRA AFAMNSYFKS KLGVDSACDF GGTGQLTTVD PSYGNCRYV* |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
pfam07983 | X8 | 5.0e-21 | 26 | 94 | 74 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. |
smart00768 | X8 | 9.0e-38 | 24 | 108 | 85 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAL92578.1 | 7e-31 | 17 | 109 | 29 | 122 | allergen Ole e 10 [Olea europaea] |
GenBank | ABK95730.1 | 2e-29 | 15 | 108 | 353 | 447 | unknown [Populus trichocarpa] |
GenBank | ACH56716.1 | 6e-31 | 15 | 108 | 365 | 457 | beta-glucosidase 08 [Solanum lycopersicum] |
EMBL | CAN83700.1 | 4e-29 | 15 | 109 | 230 | 324 | hypothetical protein [Vitis vinifera] |
RefSeq | XP_002312097.1 | 3e-29 | 15 | 108 | 353 | 447 | predicted protein [Populus trichocarpa] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 6e-27 | 13 | 108 | 3 | 96 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
CU519130 | 109 | 1 | 109 | 4.99997e-41 |
HO093120 | 91 | 20 | 110 | 3e-39 |
CU550119 | 98 | 13 | 110 | 4e-37 |
HO103166 | 87 | 20 | 106 | 5e-36 |
HO103157 | 87 | 20 | 106 | 5e-36 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|
![]() |