y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.011G269900.1
FamilyGT47
Protein PropertiesLength: 349 Molecular Weight: 39633.2 Isoelectric Point: 6.1824
ChromosomeChromosome/Scaffold: 11 Start: 60160797 End: 60162347
DescriptionExostosin family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT47432933.09999e-40
  NFKIYAYPPPETLSFDSQVESLFYSSLIHSHFITQNPEEAHLFFIPFSFHSGLSARAAAYVVGNYRTEFIYWNRTLGADHFFLSCSGIVHGADRNVVELK
  KNSVQVSCFPTTAGLFIPHKDVSLPPLANVHAPVHAPGRKSSSYLGYVKYNWVKESNIKEQLLADPEFEVESEPSDQVTYEERLAGSKFCLFEYGPEISA
  IGEAMSFGCVPVVITDRPIQDLPLMDLLTWQQIAVFVGSSGGVNEIKRVLG
Full Sequence
Protein Sequence     Length: 349     Download
MSFPPFLCFF FFVSFLPLST PLTSSPYLSP TIFHPNYQKM TQNFKIYAYP PPETLSFDSQ    60
VESLFYSSLI HSHFITQNPE EAHLFFIPFS FHSGLSARAA AYVVGNYRTE FIYWNRTLGA    120
DHFFLSCSGI VHGADRNVVE LKKNSVQVSC FPTTAGLFIP HKDVSLPPLA NVHAPVHAPG    180
RKSSSYLGYV KYNWVKESNI KEQLLADPEF EVESEPSDQV TYEERLAGSK FCLFEYGPEI    240
SAIGEAMSFG CVPVVITDRP IQDLPLMDLL TWQQIAVFVG SSGGVNEIKR VLGRVVMAEY    300
EDMRESAAVA SKHFVWNDTP QPFDAFHMVM YQLWLRRHTI RYAEREWA*                360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03016Exostosin2.0e-2544279275+
Gene Ontology
GO TermDescription
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqXP_002282317.102434729359PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002307304.102434265406predicted protein [Populus trichocarpa]
RefSeqXP_002311191.1063487345predicted protein [Populus trichocarpa]
RefSeqXP_002316258.1023483339predicted protein [Populus trichocarpa]
RefSeqXP_002524235.1013473336conserved hypothetical protein [Ricinus communis]
Signal Peptide
Cleavage Site
21
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO105146260853440
DT563490262322930
DT545902258322890
CO131604247322780
DT570960211322420
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_006_00421.1
Carica papayaevm.model.supercontig_776.2
Citrus clementinaCiclev10033889m
Citrus sinensisorange1.1g038978m.17.118orange1.1g038978m.17.118
Cucumis sativusCucsa.165010.1
Eucalyptus grandisEucgr.J02121.1
Fragaria vescamrna07685.1-v1.0-hybrid.216.351mrna20856.1-v1.0-hybridmrna07685.1-v1.0-hybrid.216.351
Glycine maxGlyma15g06366.1
Malus domesticaMDP0000813554MDP0000127117
Manihot esculentacassava4.1_001828m
Medicago truncatulaMedtr5g081290.1
Mimulus guttatusmgv1a009039m
Physcomitrella patensPp1s171_117V6.1Pp1s171_119V6.1Pp1s171_119V6.2Pp1s7_425V6.1Pp1s171_119V6.3
Picea abiesMA_9984677g0010MA_163950g0010MA_136494g0010
Populus trichocarpaPotri.007G117800.1Potri.012G091600.1Potri.008G060500.1Potri.010G197900.1
Prunus persicappa001357m
Ricinus communis30143.m001199
Selaginella moellendorffii445668
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny