y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.011G290600.1
FamilyGH85
Protein PropertiesLength: 690 Molecular Weight: 76794.5 Isoelectric Point: 4.7542
ChromosomeChromosome/Scaffold: 11 Start: 62185841 End: 62192290
DescriptionGlycosyl hydrolase family 85
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH85743550
  MQGGYVDDKWIQGGENSGAYAIWHWYLIDVFVYFSHYLVTLPPPCWTNTAHTHGVKVLGTFIVEGEEGTATCNKMLSTKESAHKYAQLLVELAVALGFDG
  WLLNMEVDLAISQIPNLKEFVSYLTQTMHSSVPGSLVIWYDSVTIDGTLSWQNQLNEENKPFFDISDGIFVNYFWEEDGPKLSATVAGDRKLDVYMGIDV
  FGRGTYGGGQWTTNVALDVIKKDDVSAAIFAPGWVYETKQPPDFQTAQNRWWSLVEKSWGIVQNYPKTLPFYSNFDQGRGNH
Full Sequence
Protein Sequence     Length: 690     Download
MSGQPNDQKS DPTPPPFDPS KPSVPISYPI KTLEDLENGS YYKSFHYPFN KSSVPLRPNT    60
GLAQRPRVLV CHDMQGGYVD DKWIQGGENS GAYAIWHWYL IDVFVYFSHY LVTLPPPCWT    120
NTAHTHGVKV LGTFIVEGEE GTATCNKMLS TKESAHKYAQ LLVELAVALG FDGWLLNMEV    180
DLAISQIPNL KEFVSYLTQT MHSSVPGSLV IWYDSVTIDG TLSWQNQLNE ENKPFFDISD    240
GIFVNYFWEE DGPKLSATVA GDRKLDVYMG IDVFGRGTYG GGQWTTNVAL DVIKKDDVSA    300
AIFAPGWVYE TKQPPDFQTA QNRWWSLVEK SWGIVQNYPK TLPFYSNFDQ GRGNHISVDG    360
AQVLSTQWNN ISSQTFQPFL EYVDDSTSKT IEVRVDFKEA SFNGGGNITF KGTLEAGASF    420
STRLFSGQLL MGPLPIYFTY SVNSEGNSQL GLSLELSSET EGKKKLFLAS QGTNQFSSEV    480
LMPRRLTTPD NAPGWVMQEV SIAMNGYTLT EIHAVCYKQQ PEITNTTEYF AVLGDIKIST    540
SSKNTEFPPS TSWIVNGQDI EWGTSQGSKT LSLKISWKPE DEKGPLFPKY NIYVEKLSKQ    600
SIRTLKGTLE SVREYIGVAH IEAFYVSQLV IPSDTSSLKF IIQVCNVDGA SQNLDDAPFF    660
QLDVQSSTNI LSLLFGCLPS LVKNIIAYL*                                     720
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG4724COG47245.0e-3949431422+
pfam03644Glyco_hydro_851.0e-12074358304+
cd06547GH85_ENGase1.0e-13269378330+
Gene Ontology
GO TermDescription
GO:0005737cytoplasm
GO:0033925mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqXP_002273683.1046653688PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002315137.102366526697predicted protein [Populus trichocarpa]
RefSeqXP_002315138.1056657694predicted protein [Populus trichocarpa]
RefSeqXP_002520781.1026654691endo beta n-acetylglucosaminidase, putative [Ricinus communis]
RefSeqXP_002520784.1016651685endo beta n-acetylglucosaminidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3fhq_F5e-284846128469A Chain A, Structure Of Endo-Beta-N-Acetylglucosaminidase A
PDB3fhq_D5e-284846128469A Chain A, Structure Of Endo-Beta-N-Acetylglucosaminidase A
PDB3fhq_B5e-284846128469A Chain A, Structure Of Endo-Beta-N-Acetylglucosaminidase A
PDB3fhq_A5e-284846128469A Chain A, Structure Of Endo-Beta-N-Acetylglucosaminidase A
PDB3fha_D5e-284846128469A Chain A, Structure Of Endo-Beta-N-Acetylglucosaminidase A
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EL437937257933490
JG6212242701183860
GR107739245683120
EL344986246893340
DW1686552561874420
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_030_00225.1
Arabidopsis lyrata497439.76.201497439.76.201872478497439.204.302487338
497439.204.302
Arabidopsis thalianaAT5G05460.1AT3G11040.1
Brachypodium distachyonBradi1g14127.1
Brassica rapaBra034160Bra005854
Carica papayaevm.model.supercontig_19.130
Capsella rubellaCarubv10000369mCarubv10013078m
Chlamydomonas reinhardtiiCre13.g582250.t1.2
Citrus clementinaCiclev10031026m.70.259Ciclev10031026m.70.259Ciclev10030777m
Cucumis sativusCucsa.144380.1Cucsa.144370.1
Eucalyptus grandisEucgr.J00174.1
Fragaria vescamrna21040.1-v1.0-hybrid
Glycine maxGlyma14g06120.2Glyma18g40011.1Glyma02g43025.1Glyma11g35630.1Glyma14g06130.1
Glyma14g06120.1Glyma18g02770.1Glyma02g43020.2
Gossypium raimondiiGorai.012G079500.1
Linum usitatissimumLus10017430Lus10007526
Manihot esculentacassava4.1_029708mcassava4.1_031267m
Medicago truncatulaMedtr3g071610.1
Mimulus guttatusmgv1a002327mmgv1a001722m
Oryza sativaLOC_Os05g27960.1
Physcomitrella patensPp1s13_33V6.2Pp1s13_33V6.1
Phaseolus vulgarisPhvul.001G245900.1
Picea abiesMA_10436931g0010MA_10435721g0010
Populus trichocarpaPotri.008G073000.1Potri.010G184300.1Potri.010G184300.2Potri.010G184200.1Potri.010G184200.2
Prunus persicappa015834m
Ricinus communis29729.m00228229729.m002279
Setaria italicaSi021368m
Selaginella moellendorffii61572
Sorghum bicolorSb09g016230.1
Thellungiella halophilaThhalv10012879mThhalv10020200m
Vitis viniferaGSVIVT01032751001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny