y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.012G009300.1
FamilyGT1
Protein PropertiesLength: 451 Molecular Weight: 49374.7 Isoelectric Point: 6.446
ChromosomeChromosome/Scaffold: 12 Start: 1004283 End: 1007107
DescriptionUDP-glucosyl transferase 78D2
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT12444194.9e-36
  ISSSTVDDSHGCLDWVSKHEAASVVYISFGSLITPPPHELQALCEALEECEFPFLWSLKGNPEKQLPQGFLERTSSKGKIVPWAPQQQILEHPSVGVFVS
  HGGWNSVLESINGGVPMICRPFFGDQQLNTRTVEVVWGFALGLEGGTLTKGGAKKALKLILCSQEGKKMREKIRVQ
Full Sequence
Protein Sequence     Length: 451     Download
MEGYKNASKH IAVLAFPFGT HAAPLLNITR QLSDACPDTM FSFLSTQQSN NSTFSKNHDK    60
IKPFNVWDGL PEGYSFRGNP HEPVDYFLKA VPGSFIKAID AVVSETGKPV DCLITDAFYA    120
FGADIADELN IPWVAVWMSG PRALFLHLQT DVIRQHVGIN NPEDKPLDFP EFSGFRVTDL    180
PNGIASGDID APMPALLHKI GVSLSRATAI VANSYEELDN TVVNMLKLRF SMFLNVGPFT    240
LVSISSSTVD DSHGCLDWVS KHEAASVVYI SFGSLITPPP HELQALCEAL EECEFPFLWS    300
LKGNPEKQLP QGFLERTSSK GKIVPWAPQQ QILEHPSVGV FVSHGGWNSV LESINGGVPM    360
ICRPFFGDQQ LNTRTVEVVW GFALGLEGGT LTKGGAKKAL KLILCSQEGK KMREKIRVQK    420
ELVCKAVKPN GSSIEDFKTL VKLLQHLPPS *                                   480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02210PLN022107.0e-331381401+
PLN02448PLN024484.0e-336442477+
PLN00164PLN001649.0e-38101446383+
PLN02555PLN025553.0e-3810441475+
PLN02410PLN024102.0e-425447460+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
Swiss-ProtA6XNC601044415452UGFGT_MEDTR RecName: Full=Flavonoid 3-O-glucosyltransferase; AltName: Full=UDP glucose:flavonoid 3-O-glucosyltransferase; AltName: Full=UDP-glycosyltransferase 78G1
GenBankACH56523.2014501450flavonoid 3-glucosyltransferase [Gossypium hirsutum]
RefSeqXP_002325073.1014411444predicted protein [Populus trichocarpa]
RefSeqXP_002327314.101044410449UDP-glucose:flavonoid 3-o-glucosyltransferase [Populus trichocarpa]
RefSeqXP_002533888.10844411452UDP-glucosyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3hbj_A01044415452A Chain A, Solution Structure Of The C-Terminal Gal-Bind Lectin Domain From Human Galectin-4
PDB3hbf_A01044415452A Chain A, Structure Of Ugt78g1 Complexed With Myricetin And Udp
PDB2c9z_A0104449450A Chain A, Structure Of Ugt78g1 Complexed With Myricetin And Udp
PDB2c1z_A0104449450A Chain A, Structure Of Ugt78g1 Complexed With Myricetin And Udp
PDB2c1x_A0104449450A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
ES80870237213710
CO0709982811334130
ES84786623612360
ES80636631113090
DT56667926412630
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_031_00073.1Aquca_031_00072.1
Arabidopsis lyrata488567326139313693488566
Arabidopsis thalianaAT5G17040.1AT1G30530.1AT5G17050.1AT5G17030.1
Brachypodium distachyonBradi1g46850.1
Brassica rapaBra023594
Carica papayaevm.model.supercontig_95.70
Capsella rubellaCarubv10000798m
Citrus clementinaCiclev10008258mCiclev10019770mCiclev10030331m
Citrus sinensisorange1.1g012893morange1.1g013878m
Cucumis sativusCucsa.092240.1Cucsa.089640.1
Eucalyptus grandisEucgr.A02964.3Eucgr.A02964.1Eucgr.E02976.1Eucgr.E02345.1Eucgr.I02607.1
Eucgr.E02973.1Eucgr.E02977.1Eucgr.C00191.1Eucgr.A02964.2Eucgr.E02398.1
Eucgr.C01022.1Eucgr.C00833.1Eucgr.A00303.1Eucgr.A00306.1Eucgr.C01021.1
Eucgr.C01020.1Eucgr.C01017.1Eucgr.D00702.1Eucgr.C00831.1Eucgr.L02741.1
Eucgr.L02520.1Eucgr.C01063.1Eucgr.E02978.1Eucgr.A00304.1
Fragaria vescamrna30947.1-v1.0-hybridmrna12591.1-v1.0-hybridmrna19962.1-v1.0-hybridmrna24693.1-v1.0-hybridmrna11466.1-v1.0-hybrid
mrna11467.1-v1.0-hybridmrna13747.1-v1.0-hybridmrna29614.1-v1.0-hybrid
Glycine maxGlyma07g30200.1Glyma13g01220.1Glyma07g30180.1Glyma08g07130.1Glyma07g30190.1
Glyma13g32910.1Glyma17g07341.1Glyma15g06390.1Glyma06g39350.2Glyma0060s00320.2
Gossypium raimondiiGorai.003G051800.1Gorai.004G101100.1Gorai.012G009400.1Gorai.012G009500.1Gorai.010G063400.1
Gorai.009G050700.1Gorai.008G018000.1
Linum usitatissimumLus10025854
Malus domesticaMDP0000543445MDP0000638691MDP0000478252MDP0000405936
Manihot esculentacassava4.1_007209mcassava4.1_031308mcassava4.1_033139mcassava4.1_028603m
Medicago truncatulaMedtr4g128690.1Medtr4g128720.1
Mimulus guttatusmgv1a006133mmgv1a006788m
Oryza sativaLOC_Os06g09240.1LOC_Os07g05420.1
Panicum virgatumPavirv00029337mPavirv00050970mPavirv00041516mPavirv00063020m
Phaseolus vulgarisPhvul.006G201100.1Phvul.002G214500.1Phvul.003G148300.1Phvul.002G214300.1Phvul.002G214400.1
Populus trichocarpaPotri.013G118700.1Potri.018G096000.1Potri.006G171100.1Potri.006G171200.1Potri.013G143900.1
Potri.009G133300.1Potri.009G078400.1Potri.019G090400.1
Prunus persicappa015939mppa019430mppa015221mppa017941mppa005162m
Ricinus communis28479.m00004729804.m00155830073.m002239
Setaria italicaSi006338mSi010039m
Selaginella moellendorffii105043445660
Sorghum bicolorSb10g006140.1Sb02g038860.1
Thellungiella halophilaThhalv10013472m
Vitis viniferaGSVIVT01037410001GSVIVT01037413001GSVIVT01029129001GSVIVT01029126001GSVIVT01029122001
GSVIVT01024419001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)