y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.012G040000.1
FamilyGT48
Protein PropertiesLength: 1921 Molecular Weight: 223626 Isoelectric Point: 8.8583
ChromosomeChromosome/Scaffold: 12 Start: 4964230 End: 4988423
Descriptionglucan synthase-like 7
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT48103617680
  VPPNLEARRRITFFANSLFMNMPSAPKVRDMLSFSVLTPYYKEDVLYSDEELTKENEDGISILFYLQRIYPDEWNNFLERVQPSENKDESEEARLKEEVR
  KWVSYRGQTLSKTVRGMMYYRQALELQYCLEFSDDSEILGGFQAFEDDPRYIEQAQALANMKFTYVVSCQVYGAQKKSSDQRDRSCYLNILNLMLKYPSL
  RVAYIDEREETVDGISQKVYYSVLVKGGEKLDEEIYRIRLPGPPTEIGEGKPENQNHAIIFTRGEALQTIDMNQDNYFEEAYKMRNVLEEFLKARHKERK
  PSILGLREHIFTGSVSSLAWFMSNQETSFVTIGQRILANPLRVRFHYGHPDIFDRIFHLTRGGISKASKIINLSEDIFAGFNSTLRGGYVTHHEYIQVGK
  GRDVGMNQISAFEAKVANGNGEQTLSRDVYRLGRRFDFYRMLSFYFTTVGFYFSSMVTVLIVYVFLYGRLYMVMSGLEQEIIENATIHQSKALEEALATQ
  SVFQLGLLLVLPMVMEIGLEKGFRTALGDFIIMQLQLASVFFTFQLGTKAHYYGRTILHGGSKYRATGRGFVVFHARFADNYRLYSRSHFVKGLELLILL
  VLYEVYGQSYRSSSLYMFITVSMWFLVGSWLFAPFVFNPSGFDWQKTVDDWTDWKRWMGNRGGIGINPNKSWESWWEEEQEHLKFTNIRGRLLEIILVFR
  FFIYQYGIVYHLDIAHHSKKILVYGLSWLVMLT
Full Sequence
Protein Sequence     Length: 1921     Download
MASSSGLART PSKRMSRAQT MMVEIPNEDN STADSELVPS SLASIAPILR VANEIEKDNP    60
RVAYLCRFHA FEKAHQMDPT SSGRGVRQFK TYLLHRLERE EEETKPMLAR NDPREIQMYY    120
QQFYLKNIAD GQYTKKPEEM AKIYQIASVL FDVLRTVVPV GRVDDQTQRF ADEVEKKKEQ    180
FEHYNILPLY AVGVKPAIME LPEIQAALRA IQNVEGLPVA RHTSDDTRQE RGKPVNDVLD    240
WLSFHFGFQK GNVANQREHL ILLLANMDVR KKENLEGYTT LNADTIRKLV DKVFKNYRSW    300
CNYLRCKSHL RQQLELIYIS LYLLIWGEAS NIRFMPECLC YIFHNMANEV YGILFSNARP    360
VSGDTYENAP PDDEAFLRNV ITPIYKVLQR EVKRNKGGKA SHSKWRNYDD LNEYFWSGKC    420
FQLKWPMNVK ADFFAHSDDP PLANETNNQI TVGKRKPKTN FVEARTFWHL YRSFDRMWIF    480
FIMAFQAMLI VAWNSGSLLG FFDEDVFRKV LTIFITAAFL NFLQATLDII LSFNAWRSLN    540
FSQILRYLAK FAIAAFWAVV LPLAYSSSVQ NPTGLVRFFS SWINDWQNES LYNYCLAIYL    600
IPNILAAIIF LLPPLRRRME RSNWRIVTLF MWWAQASITY IFSFHYLPKL YVGRGMHEDF    660
FSLLKYTMFW ILLLISKLAF SYYVEILPLV QPTKIIMELH VDNYQWHEFF SEVKTHNIGV    720
VIAIWSPIVL VYFMDAQIWY AIFSTLFGGI RGAFSHLGEI RTLGMLRSRF ESVPRAFCRR    780
LVPSPNQHNR KRHLDEATER KNIASFSLVW NKFIHSMRMQ DLISDRDRDL LLVPSSSSDV    840
SVVQWPPFLL ASKIPIALDM AKDFKKKDDA GLFKKIETDD YMHSAVIECY ETLRDILYNL    900
LDDDADRLIV KEICYEVDMS IHQRRFLTDF RMSGLPALSN RLEKFLGILL SNVEDVDTFR    960
SQIINVLQDI MEIITQDVMV NGSGIIARAH RHHEGDQKKE QRFEKINIDL IQMKTWREKI    1020
IRLYLLLTVK ESAINVPPNL EARRRITFFA NSLFMNMPSA PKVRDMLSFS VLTPYYKEDV    1080
LYSDEELTKE NEDGISILFY LQRIYPDEWN NFLERVQPSE NKDESEEARL KEEVRKWVSY    1140
RGQTLSKTVR GMMYYRQALE LQYCLEFSDD SEILGGFQAF EDDPRYIEQA QALANMKFTY    1200
VVSCQVYGAQ KKSSDQRDRS CYLNILNLML KYPSLRVAYI DEREETVDGI SQKVYYSVLV    1260
KGGEKLDEEI YRIRLPGPPT EIGEGKPENQ NHAIIFTRGE ALQTIDMNQD NYFEEAYKMR    1320
NVLEEFLKAR HKERKPSILG LREHIFTGSV SSLAWFMSNQ ETSFVTIGQR ILANPLRVRF    1380
HYGHPDIFDR IFHLTRGGIS KASKIINLSE DIFAGFNSTL RGGYVTHHEY IQVGKGRDVG    1440
MNQISAFEAK VANGNGEQTL SRDVYRLGRR FDFYRMLSFY FTTVGFYFSS MVTVLIVYVF    1500
LYGRLYMVMS GLEQEIIENA TIHQSKALEE ALATQSVFQL GLLLVLPMVM EIGLEKGFRT    1560
ALGDFIIMQL QLASVFFTFQ LGTKAHYYGR TILHGGSKYR ATGRGFVVFH ARFADNYRLY    1620
SRSHFVKGLE LLILLVLYEV YGQSYRSSSL YMFITVSMWF LVGSWLFAPF VFNPSGFDWQ    1680
KTVDDWTDWK RWMGNRGGIG INPNKSWESW WEEEQEHLKF TNIRGRLLEI ILVFRFFIYQ    1740
YGIVYHLDIA HHSKKILVYG LSWLVMLTGL LVLKMVSMGR RRFGTDFQLM FRILKALLFL    1800
GFLSVMTVLF VVCGLTISDL FAAILAFLPT GWAILLIGQA MRPVLKSLKF WDSIKELARG    1860
YEYIMGLVLF MPTAILSWFP FVSEFQTRLL FNQAFSRGLQ ISMILAGRKE KDITSPVKYA    1920
*                                                                    1980
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam04652DUF6056.0e-643156121+
pfam14288FKS1_dom11.0e-47326428104+
pfam02364Glucan_synthase010361750796+
Gene Ontology
GO TermDescription
GO:00001481,3-beta-D-glucan synthase complex
GO:00038431,3-beta-D-glucan synthase activity
GO:0006075(1->3)-beta-D-glucan biosynthetic process
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_172136.1091915221931ATGSL07 (glucan synthase-like 7); 1,3-beta-glucan synthase/ transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqNP_191469.202191531932ATGSL11 (glucan synthase-like 11); 1,3-beta-glucan synthase/ transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqXP_002300874.101191811927predicted protein [Populus trichocarpa]
RefSeqXP_002307554.101191011928predicted protein [Populus trichocarpa]
RefSeqXP_002526651.101191011902transferase, transferring glycosyl groups, putative [Ricinus communis]
Transmembrane Domains
StartEnd
478500
510532
544566
591613
626648
668690
719741
14791501
16191641
16511673
17271746
17561773
17931815
18201839
18601882
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO425519627128819100
HO780746516106615690
HO780496339134316810
HO780496132122413420
HO780496204167018720
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_056_00094.1Aquca_014_00906.1Aquca_019_00181.4Aquca_019_00181.3Aquca_019_00181.1
Aquca_016_00166.1Aquca_019_00181.2Aquca_084_00016.4Aquca_084_00016.3Aquca_084_00016.2
Aquca_084_00016.1Aquca_022_00132.2Aquca_022_00132.1Aquca_014_00908.4Aquca_014_00908.3
Aquca_014_00908.2Aquca_014_00908.1Aquca_014_00908.5Aquca_008_00266.1Aquca_039_00091.4
Aquca_039_00091.2Aquca_039_00091.1Aquca_039_00091.3Aquca_056_00094.2
Arabidopsis lyrata340908482666470669899601907409
878725482124490214490142897726
325786
Arabidopsis thalianaAT3G07160.1AT2G36850.1AT1G06490.1AT4G03550.1AT2G13680.1
AT1G05570.2AT1G05570.1AT4G04970.1AT3G59100.1AT2G31960.2
AT2G31960.1AT5G13000.1AT5G13000.2AT3G14570.2AT3G14570.1
AT5G36870.1
Brachypodium distachyonBradi1g51757.1Bradi1g77247.2Bradi1g77247.1Bradi1g47427.1Bradi2g50140.1
Bradi3g60790.2Bradi3g60790.1Bradi1g29622.1Bradi1g76617.1Bradi2g46250.1
Bradi2g40460.1Bradi3g09317.1Bradi2g40430.1
Brassica rapaBra005239Bra029628Bra001239Bra040364Bra015504
Bra034218Bra032416Bra037213Bra029541Bra015436
Bra003364Bra023386Bra008864Bra005624Bra027328
Carica papayaevm.model.supercontig_42.151evm.model.supercontig_189.7evm.model.supercontig_25.167evm.model.supercontig_858.3evm.model.supercontig_2050.2
evm.model.supercontig_3407.1evm.model.supercontig_50.100evm.model.supercontig_4.57
Capsella rubellaCarubv10022498mCarubv10022499m
Citrus clementinaCiclev10014066mCiclev10018457mCiclev10018456mCiclev10000018mCiclev10018223m
Ciclev10030477mCiclev10030476mCiclev10014015mCiclev10030481mCiclev10030478m
Ciclev10030495mCiclev10024186mCiclev10030599mCiclev10030560mCiclev10030796m
Citrus sinensisorange1.1g000946morange1.1g000813morange1.1g000382morange1.1g000253morange1.1g000219m
orange1.1g000179morange1.1g000260morange1.1g000273morange1.1g000180morange1.1g000261m
orange1.1g045737morange1.1g000259morange1.1g000258morange1.1g001004morange1.1g000585m
orange1.1g000171morange1.1g000349morange1.1g000165morange1.1g001473morange1.1g000389m
orange1.1g000385morange1.1g040336morange1.1g000763m
Cucumis sativusCucsa.157510.4Cucsa.157510.3Cucsa.157510.2Cucsa.157510.1Cucsa.142920.1
Cucsa.249900.1Cucsa.119100.1Cucsa.126670.1Cucsa.239610.1Cucsa.049980.10
Cucsa.142930.1Cucsa.049980.1Cucsa.058220.1Cucsa.058230.1
Eucalyptus grandisEucgr.B00160.1Eucgr.B03640.2Eucgr.B03640.1Eucgr.I00208.1Eucgr.K01028.4
Eucgr.K01028.3Eucgr.K01028.2Eucgr.K01028.1Eucgr.D00621.1Eucgr.A01821.1
Eucgr.K01027.1Eucgr.D00622.1Eucgr.J00836.1Eucgr.J00827.1Eucgr.F01403.1
Eucgr.A01827.1Eucgr.A02008.1Eucgr.A01817.1Eucgr.A01994.2Eucgr.A01994.1
Eucgr.A02010.1Eucgr.J00836.2Eucgr.A01997.1
Fragaria vescamrna09912.1-v1.0-hybridmrna17912.1-v1.0-hybridmrna17710.1-v1.0-hybridmrna28731.1-v1.0-hybridmrna02397.1-v1.0-hybrid
mrna24411.1-v1.0-hybridmrna26782.1-v1.0-hybridmrna28728.1-v1.0-hybrid.526.840mrna28728.1-v1.0-hybrid.526.840
Glycine maxGlyma06g18216.1Glyma04g36725.1Glyma20g38860.1Glyma10g44150.1Glyma05g32500.4
Glyma05g32500.3Glyma05g32500.2Glyma08g16660.1Glyma04g39120.2Glyma04g39120.1
Glyma13g37290.2Glyma08g42150.3Glyma08g42150.2Glyma08g42150.1Glyma18g12870.3
Glyma18g12870.2Glyma18g12870.1Glyma15g08020.3Glyma15g08020.2Glyma15g08020.1
Glyma15g42330.4Glyma15g42330.3Glyma15g42330.2Glyma18g53823.1Glyma08g47670.1
Glyma08g47670.2Glyma18g13105.9Glyma18g13105.8Glyma18g13105.7Glyma18g13105.6
Glyma18g13105.10Glyma18g13105.3Glyma18g13105.2Glyma18g13105.1Glyma18g13105.5
Glyma18g13105.4Glyma15g39420.2Glyma13g33560.1Glyma05g32500.6Glyma05g32500.5
Glyma08g42110.1Glyma06g44770.3Glyma06g44770.2Glyma13g31310.1Glyma06g44770.4
Glyma10g44150.2Glyma08g16715.1Glyma06g15860.1.320.682Glyma06g15860.1.320.682Glyma08g16730.2
Gossypium raimondiiGorai.004G018200.3Gorai.004G018200.1Gorai.004G018200.2Gorai.003G109000.6Gorai.003G109000.1
Gorai.003G109000.2Gorai.003G109000.3Gorai.003G109000.4Gorai.011G120300.1Gorai.005G201500.2
Gorai.005G201500.1Gorai.011G119900.1Gorai.013G075600.1Gorai.004G092500.3Gorai.004G092500.2
Gorai.004G092500.1Gorai.011G096900.3Gorai.011G096900.1Gorai.004G092600.3Gorai.004G092600.1
Gorai.009G169700.3Gorai.009G169700.2Gorai.009G169700.1Gorai.012G187400.3Gorai.012G187400.2
Gorai.012G187400.1Gorai.004G092600.2Gorai.004G092600.4Gorai.012G040000.2Gorai.005G042700.1
Gorai.005G043100.1Gorai.012G128700.1Gorai.007G334800.1Gorai.007G334800.2Gorai.003G109000.5
Linum usitatissimumLus10014796Lus10032463Lus10039828Lus10000266Lus10031648
Lus10033689Lus10001424Lus10001056Lus10003920Lus10039199
Lus10037469Lus10013744Lus10033483Lus10007327Lus10030030
Lus10042478Lus10020893Lus10020750Lus10040891.301.669Lus10040891.301.669
Lus10002096Lus10002097
Malus domesticaMDP0000174437MDP0000286691MDP0000245319MDP0000275961MDP0000915307
MDP0000229527MDP0000230907MDP0000203763MDP0000321472MDP0000220467
MDP0000308574MDP0000198973MDP0000230621MDP0000212172.415.839MDP0000212172.415.839
MDP0000372473MDP0000310065MDP0000213931MDP0000218486.624.863MDP0000218486.624.863
MDP0000218486.624.863
Manihot esculentacassava4.1_001919mcassava4.1_031653mcassava4.1_029201mcassava4.1_000111mcassava4.1_000342m
cassava4.1_000112mcassava4.1_000082mcassava4.1_026004mcassava4.1_002527mcassava4.1_003374m
cassava4.1_003342mcassava4.1_006866mcassava4.1_028751mcassava4.1_033421m
Medicago truncatulaMedtr4g078220.1Medtr3g047390.1Medtr7g005950.1Medtr1g116370.1AC235753_1023.1
Medtr1g116470.1.521.981Medtr1g116470.1.521.981Medtr1g116470.1.228.504Medtr1g116470.1.228.504
Mimulus guttatusmgv1a000080mmgv1a000075mmgv1a000084mmgv1a000082mmgv1a000070m
mgv1a000067mmgv1a000108mmgv1a024191mmgv1a000066mmgv1a000106m
mgv1a000068m
Oryza sativaLOC_Os06g08380.1LOC_Os02g58560.1LOC_Os01g55040.1LOC_Os06g51270.1LOC_Os03g03610.3
LOC_Os03g03610.2LOC_Os03g03610.1LOC_Os02g58560.3LOC_Os02g14900.1LOC_Os01g34930.1
LOC_Os01g48200.1LOC_Os01g34890.1LOC_Os01g34880.1
Panicum virgatumPavirv00009928mPavirv00009617mPavirv00009495mPavirv00057448mPavirv00022973m
Pavirv00045342mPavirv00015084mPavirv00020404mPavirv00041942mPavirv00010502m
Pavirv00026821mPavirv00007196mPavirv00061397mPavirv00045035mPavirv00040188m
Pavirv00056028mPavirv00049749mPavirv00048524mPavirv00058599m
Physcomitrella patensPp1s88_136V6.1Pp1s160_88V6.1Pp1s40_186V6.2Pp1s67_234V6.1Pp1s67_70V6.1
Pp1s145_49V6.1Pp1s18_300V6.2Pp1s199_13V6.1Pp1s13_132V6.1Pp1s13_432V6.1
Pp1s379_24V6.1Pp1s66_72V6.1
Phaseolus vulgarisPhvul.007G004900.2Phvul.007G004900.1Phvul.007G004900.3Phvul.002G272000.1Phvul.009G150300.2
Phvul.009G150300.1Phvul.011G113800.1Phvul.006G185600.2Phvul.006G185600.1Phvul.006G032100.1
Phvul.006G031900.1Phvul.005G103600.1Phvul.008G002300.1Phvul.005G040900.2Phvul.007G005100.1
Phvul.005G040900.1Phvul.005G062500.1Phvul.009G169400.1
Picea abiesMA_10428413g0040MA_826577g0010MA_960362g0010MA_10426974g0030MA_735748g0010
MA_6205g0020MA_10426974g0020MA_10430560g0010MA_10431062g0010MA_229544g0010
MA_10434444g0010MA_10431631g0010
Populus trichocarpaPotri.015G089300.1Potri.001G011900.1Potri.005G058300.2Potri.005G058300.1Potri.013G131300.1
Potri.001G230000.9Potri.001G230000.8Potri.001G230000.7Potri.001G230000.6Potri.001G230000.5
Potri.001G230000.4Potri.001G230000.3Potri.001G230000.2Potri.001G230000.17Potri.001G230000.16
Potri.011G052400.6Potri.011G052400.5Potri.011G052400.4Potri.011G052400.3Potri.011G052400.2
Potri.011G052400.1Potri.002G058700.3Potri.002G058700.2Potri.002G058700.1Potri.001G012200.3
Potri.001G012200.1Potri.001G012200.2Potri.005G203500.2Potri.005G203500.1Potri.003G214200.2
Potri.003G214200.1Potri.011G095100.2Potri.011G095100.1Potri.001G230000.10Potri.001G230000.18
Potri.001G012200.5Potri.001G012200.4Potri.005G203500.3Potri.001G230000.11Potri.001G230000.12
Potri.001G230000.13
Prunus persicappa000071mppa000167mppa000077mppa000074mppa001863m
ppa000121mppa000112mppa002267mppa000073mppa003008m
ppa000306m
Ricinus communis30147.m01381228035.m00035829691.m00028229983.m00319129734.m000419
28035.m00035929759.m00028130226.m00202329983.m00319229851.m002416
Setaria italicaSi033860mSi034369mSi034352mSi008368mSi016068m
Si016067mSi000021mSi000023mSi000022mSi000017m
Si033956mSi033893mSi033872mSi016150mSi000059m
Selaginella moellendorffii133452439692163802267830177798
449402
Sorghum bicolorSb10g005550.1Sb04g038510.1Sb10g030970.1Sb01g048630.1Sb03g023490.1
Sb03g030800.1Sb03g034880.1Sb04g008830.1
Thellungiella halophilaThhalv10019878mThhalv10016126mThhalv10006529mThhalv10022518mThhalv10028360m
Thhalv10028359mThhalv10006533mThhalv10006528mThhalv10016125mThhalv10012412m
Thhalv10005734mThhalv10019876mThhalv10029222m
Vitis viniferaGSVIVT01025370001GSVIVT01007560001GSVIVT01026489001GSVIVT01001361001GSVIVT01020854001
GSVIVT01025362001GSVIVT01000622001GSVIVT01005204001GSVIVT01020548001.494.863GSVIVT01020548001.494.863
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)