y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.012G050700.1
FamilyGT1
Protein PropertiesLength: 477 Molecular Weight: 51767.2 Isoelectric Point: 7.0028
ChromosomeChromosome/Scaffold: 12 Start: 6590189 End: 6591750
DescriptionUDP-glucosyl transferase 88A1
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT11334474.5e-38
  VDLGVRNYIVSTTSLKFLSLMAYLPVLTTSDAAKLVDGATEIEIPGLTPLPISSIPPPFFNADHGFTATLVSNAKALPFCNGILMNTFESFEPETLSAIN
  NKRALSNLPSILPIGPLETYGLNMNGQTRYLPWLNDQPAESVVFLSFGSRTAMSKDQIKELSDGLERSGYRFLWVLKTKKVDKDEKEDLGEILSSSFLER
  TKNRGMVIKEWVNQQDILGNAAIGGFVTHCGWNSVMEAAGNGVPVLAWPQHGDQRTNAEVLEKAGLGIWDATWGWGGQRLVKQDEIQRKISELMTDEKLK
  SKAKSVGDEAKKATG
Full Sequence
Protein Sequence     Length: 477     Download
MSISPGSVTS QPHIALFPSA GMGHLTPFLR LASLLLSHNC KLTLITTKPT VSVAECTHIS    60
SFLSKHPEIN HIEFHVPPMQ HSGSISDDPF FIQFEATSRS AHQIHPLLAS LTPPVSAIFA    120
DLVVANGANK VAVDLGVRNY IVSTTSLKFL SLMAYLPVLT TSDAAKLVDG ATEIEIPGLT    180
PLPISSIPPP FFNADHGFTA TLVSNAKALP FCNGILMNTF ESFEPETLSA INNKRALSNL    240
PSILPIGPLE TYGLNMNGQT RYLPWLNDQP AESVVFLSFG SRTAMSKDQI KELSDGLERS    300
GYRFLWVLKT KKVDKDEKED LGEILSSSFL ERTKNRGMVI KEWVNQQDIL GNAAIGGFVT    360
HCGWNSVMEA AGNGVPVLAW PQHGDQRTNA EVLEKAGLGI WDATWGWGGQ RLVKQDEIQR    420
KISELMTDEK LKSKAKSVGD EAKKATGNGG TSKNTILETI ESLKQNVQTV LGTRKN*       480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN03015PLN030152.0e-4911458464+
PLN02167PLN021671.0e-5317452469+
PLN03004PLN030047.0e-5414454457+
PLN00164PLN001641.0e-6012452477+
PLN02554PLN025544.0e-6318468479+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEAZ00578.101046418474hypothetical protein OsI_22597 [Oryza sativa Indica Group]
GenBankEAZ00579.101046418474hypothetical protein OsI_22598 [Oryza sativa Indica Group]
GenBankEAZ00582.101046418477hypothetical protein OsI_22600 [Oryza sativa Indica Group]
RefSeqXP_002306046.101346011455predicted protein [Populus trichocarpa]
RefSeqXP_002532899.101346511461UDP-glucosyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vg8_A0124567460A Chain A, Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase Isoenzyme Exo1 In Complex With Gluco-Phenylimidazole
PDB2vch_A0124567460A Chain A, Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase Isoenzyme Exo1 In Complex With Gluco-Phenylimidazole
PDB2vce_A0124567460A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2acv_B034631461A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
PDB2acv_A034631461A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CT845041446104510
EX6644252151914020
EY0808992452194630
GR1538912191914090
GR1730162111994090
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_00760.1Aquca_002_00759.1
Brachypodium distachyonBradi1g44630.1Bradi1g43410.1
Citrus clementinaCiclev10013670mCiclev10031419m
Citrus sinensisorange1.1g043530morange1.1g012061m
Cucumis sativusCucsa.284670.1
Eucalyptus grandisEucgr.E03235.1Eucgr.E03236.1Eucgr.D01288.1Eucgr.E03234.1Eucgr.E03232.1
Eucgr.E03231.1Eucgr.J01468.1Eucgr.E03233.1
Fragaria vescamrna04355.1-v1.0-hybridmrna04357.1-v1.0-hybridmrna04359.1-v1.0-hybrid
Glycine maxGlyma09g29160.1Glyma16g33750.1
Gossypium raimondiiGorai.013G091400.3Gorai.013G091400.2Gorai.013G091400.4
Linum usitatissimumLus10036967Lus10036969Lus10037114
Malus domesticaMDP0000286574MDP0000120215MDP0000253523MDP0000544455MDP0000548511
Manihot esculentacassava4.1_007235mcassava4.1_007252mcassava4.1_022558m
Medicago truncatulaMedtr4g082810.1Medtr6g078320.1Medtr4g082820.1
Mimulus guttatusmgv1a022922mmgv1a006046mmgv1a020049m
Oryza sativaLOC_Os06g18670.1LOC_Os06g18010.1LOC_Os06g18140.1LOC_Os06g18790.1
Panicum virgatumPavirv00001007mPavirv00009357mPavirv00054865m
Phaseolus vulgarisPhvul.004G138400.1Phvul.004G138200.1Phvul.004G137900.1Phvul.004G137900.2
Populus trichocarpaPotri.017G089000.1Potri.004G126000.1
Prunus persicappa005427mppa027121mppa015845mppa023609m
Ricinus communis28124.m000238
Setaria italicaSi007944mSi006299mSi006342m
Sorghum bicolorSb10g001230.1Sb07g002370.1Sb10g010640.1Sb10g010590.1Sb10g010610.1
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny