y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.012G068200.2
FamilyGH20
Protein PropertiesLength: 406 Molecular Weight: 46482 Isoelectric Point: 6.0981
ChromosomeChromosome/Scaffold: 12 Start: 9957603 End: 9965307
Descriptionbeta-hexosaminidase 1
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH201834050
  YIKDKPRFAFRGLMLDTSRHYLPIDVIKQIIESMSYAKLNVLHWHIIDEESFPLEVPSYPKLWNGAYTKWERYTIEDASEIVSFAKMRGIHIMAEVDVPG
  HAESWGAGYPDLWPSSTCREPLDVSKSFTFDLISGILSEMRKIFPFELFHLGGDEVHTDCWTSTPHIKQWLNDQNMTAKDAYQYFVLKAQEIAISKNWTP
  VNWEETFNSFPSKLNPRTIVHNW
Full Sequence
Protein Sequence     Length: 406     Download
MLRFSQNSHY KLSFLVLVLW VSHLVDSKSG FELDEPLTYL WPLPSEFTSG NQTLTVDPTL    60
SFSALGKGGN SKILIEGFER YKKIIFKHVS GISLFGKSRG IRSVYDISEL RFIVNSDSEE    120
LQLGVDESYT LFVAKKDGKS IVGEATIEAN TVYGALRGLE TFSQLCAFDY ETKSVQIYKA    180
PWYIKDKPRF AFRGLMLDTS RHYLPIDVIK QIIESMSYAK LNVLHWHIID EESFPLEVPS    240
YPKLWNGAYT KWERYTIEDA SEIVSFAKMR GIHIMAEVDV PGHAESWGAG YPDLWPSSTC    300
REPLDVSKSF TFDLISGILS EMRKIFPFEL FHLGGDEVHT DCWTSTPHIK QWLNDQNMTA    360
KDAYQYFVLK AQEIAISKNW TPVNWEETFN SFPSKLNPRT IVHNW*                   420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd02742GH20_hexosaminidase2.0e-42193405225+
cd06570GH20_chitobiase-like_19.0e-49190405231+
cd06563GH20_chitobiase-like5.0e-50190405247+
pfam00728Glyco_hydro_203.0e-74190405229+
cd06562GH20_HexA_HexB-like6.0e-97190405228+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004563beta-N-acetylhexosaminidase activity
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAE99290.10114057400beta-N-acetylhexosaminidase -like protein [Arabidopsis thaliana]
EMBLCAB75760.103940532416beta-N-acetylhexosaminidase-like protein [Arabidopsis thaliana]
RefSeqNP_567017.20114057400HEXO1 (BETA-HEXOSAMINIDASE 1); beta-N-acetylhexosaminidase/ hexosaminidase/ hydrolase, hydrolyzing O-glycosyl compounds [Arabidopsis thaliana]
RefSeqXP_002282535.101540516400PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002316315.10134053390predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2gjx_G0354052375B Chain B, X-Ray Crystal Structure Of Ngt-Bound Hexa
PDB2gjx_F0354052375B Chain B, X-Ray Crystal Structure Of Ngt-Bound Hexa
PDB2gjx_C0354052375B Chain B, X-Ray Crystal Structure Of Ngt-Bound Hexa
PDB2gjx_B0354052375B Chain B, X-Ray Crystal Structure Of Ngt-Bound Hexa
PDB1np0_B0354052375B Chain B, X-Ray Crystal Structure Of Ngt-Bound Hexa
Signal Peptide
Cleavage Site
27
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DY275488345573960
DY302201332804050
DT56925724212420
FC899714290573410
CU530920246633080
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_022_00071.4Aquca_022_00071.3Aquca_022_00071.2Aquca_022_00071.1Aquca_010_00682.1
Aquca_004_00645.1
Arabidopsis lyrata475658485946470561
Arabidopsis thalianaAT1G65590.1AT3G55260.1AT1G05590.1
Brachypodium distachyonBradi2g57420.1Bradi2g25310.1Bradi2g37460.1Bradi3g44607.1Bradi1g69660.1
Bradi1g23740.1
Brassica rapaBra004121Bra014765Bra032460
Carica papayaevm.model.supercontig_197.26
Capsella rubellaCarubv10020116mCarubv10016974mCarubv10011603m
Chlamydomonas reinhardtiig11709.t1
Citrus clementinaCiclev10014808mCiclev10031174mCiclev10031139mCiclev10031669mCiclev10033772m
Ciclev10019509mCiclev10024601m
Citrus sinensisorange1.1g008945morange1.1g013337morange1.1g008821morange1.1g014971morange1.1g044344m
orange1.1g007722morange1.1g007610m
Cucumis sativusCucsa.165600.1Cucsa.178740.1Cucsa.165600.2.144.314Cucsa.165600.2.144.314Cucsa.177460.1
Cucsa.165600.2.312.421Cucsa.165600.2.312.421
Eucalyptus grandisEucgr.G02896.1Eucgr.L01476.1Eucgr.K02799.2Eucgr.K02799.1Eucgr.K02799.3
Eucgr.K02798.2Eucgr.K02798.1
Fragaria vescamrna26730.1-v1.0-hybridmrna02330.1-v1.0-hybrid
Glycine maxGlyma18g52290.1Glyma02g10570.1Glyma10g43710.1Glyma20g38400.1Glyma08g17200.1
Glyma08g16970.1Glyma15g41986.1
Gossypium raimondiiGorai.002G136400.2Gorai.002G136400.1Gorai.011G246500.1Gorai.012G068200.1Gorai.002G136400.3
Gorai.012G068200.3Gorai.007G264000.1
Linum usitatissimumLus10003292Lus10030323Lus10022251Lus10030348Lus10007899
Malus domesticaMDP0000798095MDP0000262060.270.444MDP0000262060.270.444MDP0000564236MDP0000262060.174.257
MDP0000262060.174.257
Manihot esculentacassava4.1_033827mcassava4.1_033064mcassava4.1_004406mcassava4.1_007813mcassava4.1_023099m
cassava4.1_021615m
Medicago truncatulaMedtr2g062560.1
Mimulus guttatusmgv1a004365mmgv1a003720mmgv1a007861mmgv1a003512mmgv1a023788m
Oryza sativaLOC_Os01g66700.1LOC_Os05g34320.2LOC_Os05g34320.1LOC_Os05g02510.1LOC_Os05g34320.3
LOC_Os07g38790.1LOC_Os03g11980.1
Panicum virgatumPavirv00023753mPavirv00005093mPavirv00062644mPavirv00067910mPavirv00063863m
Pavirv00062646mPavirv00001875mPavirv00056279mPavirv00062645m.258.396Pavirv00062645m.258.396
Pavirv00060770mPavirv00016511mPavirv00054866mPavirv00049460mPavirv00062645m.174.254
Pavirv00062645m.174.254
Physcomitrella patensPp1s70_132V6.1Pp1s3_199V6.1
Phaseolus vulgarisPhvul.008G015400.1Phvul.007G010100.1Phvul.005G045300.1Phvul.005G043200.1
Picea abiesMA_177334g0010MA_271570g0010MA_92690g0010.179.289MA_92690g0010.179.289MA_92690g0010.297.429
MA_92690g0010.297.429
Populus trichocarpaPotri.008G079400.2Potri.008G079400.1Potri.010G211000.2Potri.010G211000.1Potri.010G211000.4
Potri.010G211000.3Potri.008G079400.5Potri.008G079400.3Potri.008G079400.4Potri.001G232800.1
Potri.001G232600.1
Prunus persicappa003880mppa002753m
Ricinus communis29929.m00450328180.m00037729616.m00021628180.m00037634575.m000024
47890.m000013
Setaria italicaSi001028mSi021738mSi024695mSi021693mSi029311m
Si034794m
Selaginella moellendorffii117332429308422139422155445016
422160429325441789422260
Sorghum bicolorSb09g020420.2Sb09g020420.1Sb09g001670.1Sb02g037280.1Sb01g042640.1
Thellungiella halophilaThhalv10018379mThhalv10010264mThhalv10007181mThhalv10007179m
Vitis viniferaGSVIVT01016639001GSVIVT01006264001GSVIVT01004010001GSVIVT01006000001
Volvox carteriVocar20013124m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)