y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.012G079500.1
FamilyGH85
Protein PropertiesLength: 737 Molecular Weight: 82720.5 Isoelectric Point: 6.374
ChromosomeChromosome/Scaffold: 12 Start: 12898267 End: 12903531
DescriptionGlycosyl hydrolase family 85
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH851143950
  MQGGYVDDKWIQGGHNSGAYAIWHWYLIDVFVYFSHNLVTLPPPCWTNTAHRHGVKVLGTFITEWDEGAAICKKLLSTKESAHKYAERLAELAVALGFDG
  WLLNLEVKVDIGQIPNLKEFVSHLTQTIHSSLPGSLVIWYDSVTIDGELSWQNQLNEKNKPFFDISDGIFINYTWKEGYPKLSARVAGDRKFDVYMGIDV
  FGRGTFGGGQWTTNVALDLIKKDDVSAAVFAPGWVYETKQPPDFQTAQNRWWALVEKSWGIVQNYPKVLPFYSNFDQGRGNH
Full Sequence
Protein Sequence     Length: 737     Download
MLRLLLYFLR LFITRRTLLY LHNFFTSILK PITNLIAKIM PSQSDDHNSD PPPPPFDPSK    60
PSIPISYPIN SLEDLDSASY FTSFHYPFNK STVPLHPPNS ALPPRPRLLV CHDMQGGYVD    120
DKWIQGGHNS GAYAIWHWYL IDVFVYFSHN LVTLPPPCWT NTAHRHGVKV LGTFITEWDE    180
GAAICKKLLS TKESAHKYAE RLAELAVALG FDGWLLNLEV KVDIGQIPNL KEFVSHLTQT    240
IHSSLPGSLV IWYDSVTIDG ELSWQNQLNE KNKPFFDISD GIFINYTWKE GYPKLSARVA    300
GDRKFDVYMG IDVFGRGTFG GGQWTTNVAL DLIKKDDVSA AVFAPGWVYE TKQPPDFQTA    360
QNRWWALVEK SWGIVQNYPK VLPFYSNFDQ GRGNHISIDG AQVLSTQWNN ISSQSFQPFL    420
EYVDDPTSNT IDVRVDFSEV SFSGGGNLTF KGTLEANAYV STRLFLGELF MGGLPVRFTY    480
SVKSEGNSQL GLSLEFSSEM EGKKKLLLAS QENQFSCKFD ETIVLHQPTK SDTAPGWVIQ    540
ESNISMNGYT LTEIRAICYR KQPENSEHKS EARSKTTQDP AEYFAVLGHI SISTSIQNTE    600
FPPSTSWIVK GKDVEWGGSQ GSKTLSLKIS WKLKDGWSSR FPRYNIYVEK LIKQAVRPQG    660
RKLETPALAP PNARNGKTEV SGEYLGESQV EAFYVSDFII PSAISSLKYI IQPCDSGGAS    720
QVLDDAPFFQ FNVEGQ*                                                   780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd02874GH18_CFLE_spore_hydrolase0.002140242111+
cd00598GH18_chitinase-like9.0e-6116284181+
COG4724COG47243.0e-3788495447+
pfam03644Glyco_hydro_858.0e-124114398304+
cd06547GH85_ENGase3.0e-134109418330+
Gene Ontology
GO TermDescription
GO:0005737cytoplasm
GO:0033925mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqXP_002273683.10427362690PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002315137.106273526698predicted protein [Populus trichocarpa]
RefSeqXP_002315138.10417366696predicted protein [Populus trichocarpa]
RefSeqXP_002520781.10427362693endo beta n-acetylglucosaminidase, putative [Ricinus communis]
RefSeqXP_002520784.10407361687endo beta n-acetylglucosaminidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3fhq_F7e-318750528478A Chain A, Structure Of Endo-Beta-N-Acetylglucosaminidase A
PDB3fhq_D7e-318750528478A Chain A, Structure Of Endo-Beta-N-Acetylglucosaminidase A
PDB3fhq_B7e-318750528478A Chain A, Structure Of Endo-Beta-N-Acetylglucosaminidase A
PDB3fhq_A7e-318750528478A Chain A, Structure Of Endo-Beta-N-Acetylglucosaminidase A
PDB3fha_D9e-318750528478A Chain A, Structure Of Endo-Beta-N-Acetylglucosaminidase A
Signal Peptide
Cleavage Site
19
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EL4379372571333890
GR1077392451083520
JG6212242691584250
EL3449862461293740
EV1603082471564020
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_030_00225.1
Arabidopsis lyrata497439.76.201497439.76.201872478497439.204.302487338
497439.204.302
Arabidopsis thalianaAT5G05460.1AT3G11040.1
Brachypodium distachyonBradi1g14127.1
Brassica rapaBra034160Bra005854
Carica papayaevm.model.supercontig_19.130
Capsella rubellaCarubv10000369mCarubv10013078m
Chlamydomonas reinhardtiiCre13.g582250.t1.2
Citrus clementinaCiclev10031026m.70.259Ciclev10031026m.70.259Ciclev10030777m
Cucumis sativusCucsa.144380.1Cucsa.144370.1
Eucalyptus grandisEucgr.J00174.1
Fragaria vescamrna21040.1-v1.0-hybrid
Glycine maxGlyma14g06120.2Glyma18g40011.1Glyma02g43025.1Glyma11g35630.1Glyma14g06130.1
Glyma14g06120.1Glyma18g02770.1Glyma02g43020.2
Gossypium raimondiiGorai.011G290600.1
Linum usitatissimumLus10017430Lus10007526
Manihot esculentacassava4.1_029708mcassava4.1_031267m
Medicago truncatulaMedtr3g071610.1
Mimulus guttatusmgv1a002327mmgv1a001722m
Oryza sativaLOC_Os05g27960.1
Physcomitrella patensPp1s13_33V6.2Pp1s13_33V6.1
Phaseolus vulgarisPhvul.001G245900.1
Picea abiesMA_10436931g0010MA_10435721g0010
Populus trichocarpaPotri.008G073000.1Potri.010G184300.1Potri.010G184300.2Potri.010G184200.1Potri.010G184200.2
Prunus persicappa015834m
Ricinus communis29729.m00228229729.m002279
Setaria italicaSi021368m
Selaginella moellendorffii61572
Sorghum bicolorSb09g016230.1
Thellungiella halophilaThhalv10012879mThhalv10020200m
Vitis viniferaGSVIVT01032751001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny