y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.012G121200.2
FamilyGT31
Protein PropertiesLength: 597 Molecular Weight: 67531 Isoelectric Point: 6.7919
ChromosomeChromosome/Scaffold: 12 Start: 27632621 End: 27635165
DescriptionGalactosyltransferase family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT314365860
  ERMAVRKSWMQHKLIKSSNVVARFFVALSGRKEVNVELKKEADYFGDIVIVPYMDNYDLVVLKTVAISEYGVRTMAAKYIMKCDDDTFVRVDSVIEEAKK
  YGDKSMYIGNMNYYHKPLRDGKWAVTYEVCVFCSVLSKSRGFTFMLSNNTY
Full Sequence
Protein Sequence     Length: 597     Download
MKRSKFESLV SPSRLRLLQF LIGVLFLYLL FVSFEIPLVF KADSDGFFTD TLPRPLILES    60
EEDFSYKTAP ARPDNDPDRV HNPGSRSPEG NVREFKGVSG LLFNDSSFDN IGSKDELSVL    120
HKTARHAFVV GKKLWDDLQS GVQKSDSEPE PQSQSQNKNQ TESCPDSISL SGPEFVNQGR    180
ILVLPCGLTL GSHITVVGMP HWAHAENDPK IAVLREGDES VMVTQFMMEL QGLKTVDGED    240
PPRILHFNPR LKGDWSGKPV IEQNTCYRMQ WGSALRCEGW KSRADEETVD GEVKCEKWIR    300
DDDNGSEESK TTWWLNRLIG RKKKVTLDWQ YPFAEGKLFV LTLRAGLEGY HVNVDGRHIT    360
SFPYRTGFVL EDATGLSLKG DLDVHSVFAA SLPNSHPSFD PQKHLERLSK WKAPPLPNGN    420
VELFIGILSA GNHFAERMAV RKSWMQHKLI KSSNVVARFF VALSGRKEVN VELKKEADYF    480
GDIVIVPYMD NYDLVVLKTV AISEYGVRTM AAKYIMKCDD DTFVRVDSVI EEAKKYGDKS    540
MYIGNMNYYH KPLRDGKWAV TYEVCVFCSV LSKSRGFTFM LSNNTYCKFI SMEGFF*       600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam01762Galactosyl_T1.0e-13435563141+
smart00908Gal-bind_lectin5.0e-17185387203+
cd00070GLECT3.0e-20184388205+
pfam00337Gal-bind_lectin5.0e-24182387206+
PLN03133PLN031339.0e-82135563445+
Gene Ontology
GO TermDescription
GO:0005529Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates." [CHEBI:16646, GOC:mah]
GO:0006486protein glycosylation
GO:0008378galactosyltransferase activity
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN69092.1015631565hypothetical protein [Vitis vinifera]
EMBLCAN79615.104556754570hypothetical protein [Vitis vinifera]
RefSeqXP_002268372.104556354566PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002268603.1015631565PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002520170.10225931563transferase, transferring glycosyl groups, putative [Ricinus communis]
Transmembrane Domains
StartEnd
1739
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7994913172475620
DY2681823572005520
EX6578532892145020
EX1318483191955100
HO7994911251202447e-27
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_125_00021.1Aquca_025_00146.1Aquca_002_00412.1Aquca_025_00146.2Aquca_003_00402.1
Aquca_002_00614.1Aquca_003_00402.2Aquca_002_00412.3Aquca_002_00412.2Aquca_025_00146.3
Arabidopsis lyrata858575496442472691895345472719
477947
Arabidopsis thalianaAT4G21060.2AT4G21060.1AT5G62620.1AT1G74800.1AT1G27120.1
AT1G26810.1AT3G06440.1AT5G62620.2AT3G06440.2
Brachypodium distachyonBradi3g14370.1Bradi1g54620.1Bradi1g04957.1Bradi1g54650.1Bradi1g12000.1
Bradi1g04990.1Bradi4g01717.1Bradi3g14370.3Bradi1g04990.2Bradi2g12320.1
Bradi1g45150.1Bradi3g46820.1
Brassica rapaBra013498Bra018103Bra010102Bra024660Bra012423
Bra012408Bra016308Bra015892Bra003785Bra012440
Bra040271Bra016310
Carica papayaevm.model.supercontig_5.296evm.model.supercontig_146.63evm.model.supercontig_128.35evm.model.supercontig_121.25evm.model.supercontig_17.61
Capsella rubellaCarubv10007007mCarubv10026017mCarubv10008510mCarubv10019922mCarubv10013222m
Carubv10008767m
Citrus clementinaCiclev10014564mCiclev10014475mCiclev10019143mCiclev10030897mCiclev10004515m
Ciclev10011408mCiclev10030960mCiclev10030959mCiclev10004650mCiclev10004628m
Ciclev10019682m
Citrus sinensisorange1.1g006408morange1.1g005540morange1.1g006036morange1.1g007392morange1.1g006694m
orange1.1g006860morange1.1g006852morange1.1g008578morange1.1g006433morange1.1g008190m
orange1.1g007828morange1.1g009630morange1.1g010749m
Cucumis sativusCucsa.048010.1Cucsa.098060.1Cucsa.285560.1Cucsa.252350.2Cucsa.252350.1
Cucsa.285020.1Cucsa.285560.2Cucsa.048010.2
Eucalyptus grandisEucgr.E02455.1Eucgr.K02906.1Eucgr.B03217.1Eucgr.H04088.1Eucgr.E02455.2
Eucgr.K02906.2Eucgr.B03217.2Eucgr.B03449.1
Fragaria vescamrna30397.1-v1.0-hybridmrna09548.1-v1.0-hybridmrna00757.1-v1.0-hybridmrna05003.1-v1.0-hybrid
Glycine maxGlyma02g02900.1Glyma01g04660.1Glyma15g09810.1Glyma08g40570.1Glyma13g29280.2
Glyma18g16870.2Glyma18g16870.1Glyma08g10590.1Glyma05g27610.1Glyma04g34620.1
Glyma06g20030.1Glyma05g01570.2Glyma17g10330.1Glyma17g04230.6Glyma17g04230.5
Glyma17g04230.4Glyma17g04230.3Glyma02g12030.1Glyma01g05860.3Glyma01g05860.2
Glyma08g10590.2
Gossypium raimondiiGorai.011G048300.1Gorai.012G121200.1Gorai.003G071200.1Gorai.001G079300.1Gorai.005G189000.1
Gorai.001G079300.2Gorai.011G048300.2Gorai.006G016600.1Gorai.005G069600.2Gorai.005G069600.1
Gorai.006G016600.2Gorai.008G180600.2Gorai.008G180600.1Gorai.005G189000.2Gorai.012G187100.1
Gorai.005G069600.3Gorai.005G069600.4
Linum usitatissimumLus10036154Lus10042164Lus10004256Lus10037238Lus10036686
Lus10032650Lus10012822Lus10037171Lus10030467Lus10036756
Lus10043102
Malus domesticaMDP0000279221MDP0000398882MDP0000282228MDP0000280525MDP0000260942
MDP0000726747MDP0000768989MDP0000192362MDP0000198402MDP0000125002
Manihot esculentacassava4.1_002937mcassava4.1_003101mcassava4.1_023342mcassava4.1_003103mcassava4.1_029146m
cassava4.1_026344mcassava4.1_003587mcassava4.1_003516mcassava4.1_003277m
Medicago truncatulaMedtr2g018770.1Medtr5g037300.1Medtr7g037080.1Medtr8g061960.1Medtr5g041210.1
Mimulus guttatusmgv1a002419mmgv1a002352mmgv1a003744mmgv1a002479mmgv1a002819m
mgv1a023955mmgv1a021273m
Oryza sativaLOC_Os08g03670.1LOC_Os12g41956.1LOC_Os03g58920.2LOC_Os03g48610.1LOC_Os03g58900.1
LOC_Os07g09670.1LOC_Os07g09690.1LOC_Os01g22550.1LOC_Os06g12390.2LOC_Os06g12390.1
LOC_Os03g58920.1LOC_Os02g36770.1LOC_Os08g03670.2LOC_Os12g16480.1LOC_Os01g22550.2
Panicum virgatumPavirv00048403mPavirv00059984mPavirv00037360mPavirv00046362mPavirv00031298m
Pavirv00063126mPavirv00063125mPavirv00037359mPavirv00063124mPavirv00069573m
Pavirv00015447mPavirv00015580mPavirv00005780mPavirv00014777mPavirv00012285m
Pavirv00045787mPavirv00026686mPavirv00027395mPavirv00003964mPavirv00022644m
Pavirv00055067m
Physcomitrella patensPp1s163_84V6.1Pp1s237_65V6.1Pp1s251_37V6.1
Phaseolus vulgarisPhvul.002G079900.1Phvul.002G177500.1Phvul.009G183900.1Phvul.006G167800.1Phvul.003G071700.1
Phvul.003G194900.1Phvul.003G119000.1Phvul.002G084400.1
Picea abiesMA_103401g0010MA_10436965g0010MA_125550g0010MA_337346g0010MA_604639g0010
MA_333663g0010
Populus trichocarpaPotri.006G011300.1Potri.016G013300.1Potri.015G067600.1Potri.012G072400.1Potri.012G072400.2
Potri.010G040400.1Potri.010G040400.2Potri.010G151600.1Potri.015G067600.2Potri.010G168500.3
Potri.010G168500.4Potri.010G168500.1Potri.008G086900.1Potri.010G168500.2Potri.010G151600.2
Prunus persicappa002345mppa002606mppa002487mppa019770mppa002802m
Ricinus communis30059.m00045630147.m01404229736.m00206929889.m00336029813.m001496
28838.m000256
Setaria italicaSi013323mSi034594mSi029173mSi021423mSi029833m
Si034678mSi034769mSi000775mSi006047mSi021657m
Si016713m
Selaginella moellendorffii174046230337183099
Sorghum bicolorSb07g002630.1Sb08g021480.1Sb08g021470.1Sb01g004630.1Sb01g004660.1
Sb02g005780.1Sb02g005800.1Sb01g011450.1Sb03g013300.1Sb10g008170.1
Sb04g023900.1Sb02g005800.2
Thellungiella halophilaThhalv10024584mThhalv10003755mThhalv10018236mThhalv10006986mThhalv10020308m
Thhalv10007037mThhalv10010954mThhalv10009623m
Vitis viniferaGSVIVT01008089001GSVIVT01020111001GSVIVT01021557001GSVIVT01017641001GSVIVT01011424001
GSVIVT01019973001
Volvox carteriVocar20013846m
Zea maysAC206332.3_FGT005
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)