y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.012G151700.3
FamilyGT24
Protein PropertiesLength: 1593 Molecular Weight: 179955 Isoelectric Point: 6.2335
ChromosomeChromosome/Scaffold: 12 Start: 32540759 End: 32556725
DescriptionUDP-glucose:glycoprotein glucosyltransferases;transferases, transferring hexosyl groups;transferases, transferring glycosyl groups
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT24133315800
  INIFSIASGHLYERFLKIMILSVLKNTHRPVKFWFIKNYLSPQFKDVIPHMAQEYGFDYELVTYKWPTWLHKQTEKQRIIWAYKILFLDVIFPISLEKVI
  FVDADQVVRADMGDLYDMDIKGRPLAYTPFCDNNKDMDGYRFWRQGFWREHLRGRPYHISALYVVDLVKFRETAAGDNLRVFYESLSKDPNSLANLDQDL
  PNYAQHTVPIFSLPQEWLWCESWCGNATKSRAKTIDLCNNPMTKEPKL
Full Sequence
Protein Sequence     Length: 1593     Download
MDTCFRSRFC ILILLTCLLI SGFTFVGAQN RRPKNVQVAI RAKWSGTPLL LEAGELLSKE    60
SKNLFWEFID DWLLVGKTDD DSHSAKDCLV KILKHGSSLL SEQLASLFEF SLTLRSASPR    120
LVLYRQLAEE SLSSFPLSDD SYSHNASGVD DSEAVVTKKL DPLLVGVNPK SPRGKCCWVD    180
VGEELFFEVA ELQSWLLGPN EVNGDSFQQP ELYEFDHIHF DSNIASPVAI LYGALGTECF    240
REFHVTLVQA AKEGKVKYVV RPVLPSGCEG EVGQCGAVGA RDSLNLGGYG VELALKNMEY    300
KAMDDSTVKK GVTLEDPRTE DLSQEVRGFI FSKILERKPD LTSEIMAFRD YLLSSTISDT    360
LDVWELKDLG HQTAQRIVQA SDPLQSMQEI NQNFPSVVSS LSRMKLNDSV KDEIIANQRM    420
IPPGKSLMAL NGALINIEDI DLYLLIDLVH QELSLADQFS KLKLPRSTIR KLLSTMTPPE    480
SDAFRVDFRS DHVHYLNNLE EDAMYRRWRS NINDILMPVF PGQLRYIRKN LFHAVYVLDP    540
STVSGLQSID MITSFYENSF PMRFGVILYS TQFIKKIEQS GGELHSSEHD GELEDDKSSL    600
IIRLFIYIKE NHGIQSAFQF LSNINRLRTE SADSTDEALE MHHIEGAFVE TLLPKAKSPP    660
QEILLKLEKE QSFKELSQES SLFVFKLGVN KLQCCLLMNG LVFDSSEDAL INAMNDELPR    720
IQEQVYYGKI NSHTNVLDKF LSENGVSRYN PQIIAGGKVK PGFVSLASPA LGGESVLNEI    780
NYLHSPGTVD DVKPVTHLLA VDVTSRKGIK LLREAIRYLI QGSKNARVGV LFTAGQDANL    840
SNILLVKTFE ITAASYSHKK KVLEFLDQVC SFYEHKYILR SPAAAESTQA FINKVYELAE    900
ANELPSKTYK SSLSEAYNLK LIEHLNKVAQ YLYRQFGISS GVNAVITNGR ITSLDAGVFL    960
GDDLHLLESV EFNHRIKHIV EIVEEVSWHG IDPDMLTSKY VSDIIMLISS SMATRDRSAE    1020
SARFEILNAQ YSAVILNNEN SSIHIDAVVD PLSPSGQKLS SLLRVLAKYV HPSMRIVLNP    1080
MSSLVDLPLK NYYRYVIPTM EDFSSTDYTV NGPKAFFANM PLSKTLTMNL DVPEPWLVEP    1140
VIAVHDLDNI LLENLGDIRT LQAVFELEAL VLTGHCAEKD RDPPRGLQLI LGTKNTPHLV    1200
DTIVMANLGY WQMKVSPGVW YLQLAPGRSS ELYLFRDGGD YGNQEKSLSK RITINDLRGK    1260
VVHLEVVKKK GKEQEKLLIS SDDDKHSKEK GHNGWNSNLL KWASGFIGGS EKSKKSSDSS    1320
VDHGKGGRHG KTINIFSIAS GHLYERFLKI MILSVLKNTH RPVKFWFIKN YLSPQFKDVI    1380
PHMAQEYGFD YELVTYKWPT WLHKQTEKQR IIWAYKILFL DVIFPISLEK VIFVDADQVV    1440
RADMGDLYDM DIKGRPLAYT PFCDNNKDMD GYRFWRQGFW REHLRGRPYH ISALYVVDLV    1500
KFRETAAGDN LRVFYESLSK DPNSLANLDQ DLPNYAQHTV PIFSLPQEWL WCESWCGNAT    1560
KSRAKTIDLC NNPMTKEPKL QVIEYSSIYI RW*                                 1620
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam01501Glyco_transf_80.000313371532205+
cd04194GT8_A4GalT_like4.0e-1313331549227+
cd00505Glyco_transf_82.0e-5513331580257+
pfam06427UDP-g_GGTase3.0e-8010021207212+
cd06432GT8_HUGT1_C_like4.0e-17513331580248+
Gene Ontology
GO TermDescription
GO:0003980UDP-glucose:glycoprotein glucosyltransferase activity
GO:0006486protein glycosylation
GO:0016757transferase activity, transferring glycosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAG51883.101158111610AC016162_4 putative UDP-glucose:glycoprotein glucosyltransferase; 101200-91134 [Arabidopsis thaliana]
DDBJBAD28382.10311581351573putative UDP-glucose:glycoprotein glucosyltransferase [Oryza sativa Japonica Group]
RefSeqNP_177278.301158111549EBS1 (EMS-mutagenized bri1 suppressor 1); UDP-glucose:glycoprotein glucosyltransferase/ transferase, transferring glycosyl groups / transferase, transferring hexosyl groups [Arabidopsis thaliana]
RefSeqXP_002268972.101158111552PREDICTED: similar to EBS1 (EMS-MUTAGENIZED BRI1 SUPPRESSOR 1); UDP-glucose:glycoprotein glucosyltransferase/ transferase, transferring glycosyl groups / transferase, transferring hexosyl groups [Vitis vinifera]
RefSeqXP_002529534.101153011499UDP-glucose glycoprotein:glucosyltransferase, putative [Ricinus communis]
Transmembrane Domains
StartEnd
729
Signal Peptide
Cleavage Site
28
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO415354521107315810
DR944618254132815810
HO797114303127915810
GT619641253132815800
HO41535415392410740.000000000000002
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_023_00011.1
Arabidopsis lyrata894960
Arabidopsis thalianaAT1G71220.2AT1G71220.1
Brachypodium distachyonBradi3g28605.1
Brassica rapaBra016154
Capsella rubellaCarubv10022452m
Chlamydomonas reinhardtiig5108.t1g5108.t2
Citrus clementinaCiclev10000024m
Citrus sinensisorange1.1g001078morange1.1g000334morange1.1g000842morange1.1g001779morange1.1g000402m
orange1.1g000446morange1.1g000445m
Cucumis sativusCucsa.033020.2Cucsa.033020.1
Eucalyptus grandisEucgr.H01580.1Eucgr.I02739.1Eucgr.H01552.1.95.175Eucgr.H01552.1.95.175
Fragaria vescamrna11048.1-v1.0-hybrid
Glycine maxGlyma20g20260.1Glyma05g30230.1Glyma08g20020.1Glyma08g20020.2Glyma08g13400.1
Gossypium raimondiiGorai.012G151700.5Gorai.008G027900.1Gorai.012G151700.2Gorai.012G151700.4
Linum usitatissimumLus10019946Lus10015475
Malus domesticaMDP0000231077MDP0000439201
Manihot esculentacassava4.1_000150m
Medicago truncatulaMedtr2g006960.1
Mimulus guttatusmgv1a000151m
Oryza sativaLOC_Os02g44510.3LOC_Os02g44510.2LOC_Os02g44510.1
Panicum virgatumPavirv00007561mPavirv00061408m
Physcomitrella patensPp1s25_65V6.1
Phaseolus vulgarisPhvul.006G215600.1
Picea abiesMA_10435601g0010
Populus trichocarpaPotri.003G018900.1
Prunus persicappa000323m
Ricinus communis29222.m000396
Setaria italicaSi033881m
Selaginella moellendorffii186368
Sorghum bicolorSb04g036540.1
Thellungiella halophilaThhalv10018004m
Vitis viniferaGSVIVT01022867001
Volvox carteriVocar20012786m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny