y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.012G151700.5
FamilyGT24
Protein PropertiesLength: 1092 Molecular Weight: 123387 Isoelectric Point: 6.4165
ChromosomeChromosome/Scaffold: 12 Start: 32540759 End: 32551761
DescriptionUDP-glucose:glycoprotein glucosyltransferases;transferases, transferring hexosyl groups;transferases, transferring glycosyl groups
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT2478310300
  INIFSIASGHLYERFLKIMILSVLKNTHRPVKFWFIKNYLSPQFKDVIPHMAQEYGFDYELVTYKWPTWLHKQTEKQRIIWAYKILFLDVIFPISLEKVI
  FVDADQVVRADMGDLYDMDIKGRPLAYTPFCDNNKDMDGYRFWRQGFWREHLRGRPYHISALYVVDLVKFRETAAGDNLRVFYESLSKDPNSLANLDQDL
  PNYAQHTVPIFSLPQEWLWCESWCGNATKSRAKTIDLCNNPMTKEPKL
Full Sequence
Protein Sequence     Length: 1092     Download
MITSFYENSF PMRFGVILYS TQFIKKIEQS GGELHSSEHD GELEDDKSSL IIRLFIYIKE    60
NHGIQSAFQF LSNINRLRTE SADSTDEALE MHHIEGAFVE TLLPKAKSPP QEILLKLEKE    120
QSFKELSQES SLFVFKLGVN KLQCCLLMNG LVFDSSEDAL INAMNDELPR IQEQVYYGKI    180
NSHTNVLDKF LSENGVSRYN PQIIAGGKVK PGFVSLASPA LGGESVLNEI NYLHSPGTVD    240
DVKPVTHLLA VDVTSRKGIK LLREAIRYLI QGSKNARVGV LFTAGQDANL SNILLVKTFE    300
ITAASYSHKK KVLEFLDQVC SFYEHKYILR SPAAAESTQA FINKVYELAE ANELPSKTYK    360
SSLSEAYNLK LIEHLNKVAQ YLYRQFGISS GVNAVITNGR ITSLDAGVFL GDDLHLLESV    420
EFNHRIKHIV EIVEEVSWHG IDPDMLTSKY VSDIIMLISS SMATRDRSAE SARFEILNAQ    480
YSAVILNNEN SSIHIDAVVD PLSPSGQKLS SLLRVLAKYV HPSMRIVLNP MSSLVDLPLK    540
NYYRYVIPTM EDFSSTDYTV NGPKAFFANM PLSKTLTMNL DVPEPWLVEP VIAVHDLDNI    600
LLENLGDIRT LQAVFELEAL VLTGHCAEKD RDPPRGLQLI LGTKNTPHLV DTIVMANLGY    660
WQMKVSPGVW YLQLAPGRSS ELYLFRDGGD YGNQEKSLSK RITINDLRGK VVHLEVVKKK    720
GKEQEKLLIS SDDDKHSKEK GHNGWNSNLL KWASGFIGGS EKSKKSSDSS VDHGKGGRHG    780
KTINIFSIAS GHLYERFLKI MILSVLKNTH RPVKFWFIKN YLSPQFKDVI PHMAQEYGFD    840
YELVTYKWPT WLHKQTEKQR IIWAYKILFL DVIFPISLEK VIFVDADQVV RADMGDLYDM    900
DIKGRPLAYT PFCDNNKDMD GYRFWRQGFW REHLRGRPYH ISALYVVDLV KFRETAAGDN    960
LRVFYESLSK DPNSLANLDQ DLPNYAQHTV PIFSLPQEWL WCESWCGNAT KSRAKTIDLC    1020
NNPMTKEPKL QGARRIVSEW TDLDFEARKF TAKILGDELE NPDPLPSPSS SSPETSSNDQ    1080
SSDDLESKAE L*                                                        1140
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd06429GT8_like_10.0003806905106+
cd04194GT8_A4GalT_like1.0e-12783999227+
cd00505Glyco_transf_83.0e-557831030257+
pfam06427UDP-g_GGTase1.0e-81452657212+
cd06432GT8_HUGT1_C_like8.0e-1797831030248+
Gene Ontology
GO TermDescription
GO:0003980UDP-glucose:glycoprotein glucosyltransferase activity
GO:0006486protein glycosylation
GO:0016757transferase activity, transferring glycosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAG51883.10210915381674AC016162_4 putative UDP-glucose:glycoprotein glucosyltransferase; 101200-91134 [Arabidopsis thaliana]
GenBankEEE57527.10110855031597hypothetical protein OsJ_07839 [Oryza sativa Japonica Group]
RefSeqNP_177278.30210915181613EBS1 (EMS-mutagenized bri1 suppressor 1); UDP-glucose:glycoprotein glucosyltransferase/ transferase, transferring glycosyl groups / transferase, transferring hexosyl groups [Arabidopsis thaliana]
RefSeqXP_002268972.10110915211611PREDICTED: similar to EBS1 (EMS-MUTAGENIZED BRI1 SUPPRESSOR 1); UDP-glucose:glycoprotein glucosyltransferase/ transferase, transferring glycosyl groups / transferase, transferring hexosyl groups [Vitis vinifera]
RefSeqXP_002529534.1069805281499UDP-glucose glycoprotein:glucosyltransferase, putative [Ricinus communis]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO41535454452310540
HO79711432872910560
DR94461827677810530
GO88350331574210560
HO4153541533745240.000000000000001
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_023_00011.1
Arabidopsis lyrata894960
Arabidopsis thalianaAT1G71220.2AT1G71220.1
Brachypodium distachyonBradi3g28605.1
Brassica rapaBra016154
Capsella rubellaCarubv10022452m
Chlamydomonas reinhardtiig5108.t1g5108.t2
Citrus clementinaCiclev10000024m
Citrus sinensisorange1.1g001078morange1.1g000334morange1.1g000842morange1.1g001779morange1.1g000402m
orange1.1g000446morange1.1g000445m
Cucumis sativusCucsa.033020.2Cucsa.033020.1
Eucalyptus grandisEucgr.H01580.1Eucgr.I02739.1Eucgr.H01552.1.95.175Eucgr.H01552.1.95.175
Fragaria vescamrna11048.1-v1.0-hybrid
Glycine maxGlyma20g20260.1Glyma05g30230.1Glyma08g20020.1Glyma08g20020.2Glyma08g13400.1
Gossypium raimondiiGorai.008G027900.1Gorai.012G151700.3Gorai.012G151700.2Gorai.012G151700.4
Linum usitatissimumLus10019946Lus10015475
Malus domesticaMDP0000231077MDP0000439201
Manihot esculentacassava4.1_000150m
Medicago truncatulaMedtr2g006960.1
Mimulus guttatusmgv1a000151m
Oryza sativaLOC_Os02g44510.3LOC_Os02g44510.2LOC_Os02g44510.1
Panicum virgatumPavirv00007561mPavirv00061408m
Physcomitrella patensPp1s25_65V6.1
Phaseolus vulgarisPhvul.006G215600.1
Picea abiesMA_10435601g0010
Populus trichocarpaPotri.003G018900.1
Prunus persicappa000323m
Ricinus communis29222.m000396
Setaria italicaSi033881m
Selaginella moellendorffii186368
Sorghum bicolorSb04g036540.1
Thellungiella halophilaThhalv10018004m
Vitis viniferaGSVIVT01022867001
Volvox carteriVocar20012786m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny