y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.013G036000.1
FamilyAA1
Protein PropertiesLength: 457 Molecular Weight: 50511.9 Isoelectric Point: 7.9755
ChromosomeChromosome/Scaffold: 13 Start: 2791045 End: 2793288
DescriptionLaccase/Diphenol oxidase family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA1292940
  AAVKRYQFDVQVKNVSRLCHAKPIVTVNGMFPGPTIYARDGDRVVINVTNYAQYNMSIHWHGLKQLRNGWADGPAYITQCPIQNGHSYTYDFNVTGQRGT
  LWWHAHIFWLRATVYGAIAIMPKQGTPFPFPQPYRETNIVLGEWWNNDVEEVVKQGNKLGLPPNTSDAHTINGKPGPLFPCSEKHTFAMEVEQGKTYLLR
  IINAALNDELFFAVAGHNMTVVEIDAVYTKPFTTQAILIAPGQTTNVLVQANQAPGRYFMAARPFM
Full Sequence
Protein Sequence     Length: 457     Download
MAMGKILSSG PILLFLLYLV ALVSLPADAA VKRYQFDVQV KNVSRLCHAK PIVTVNGMFP    60
GPTIYARDGD RVVINVTNYA QYNMSIHWHG LKQLRNGWAD GPAYITQCPI QNGHSYTYDF    120
NVTGQRGTLW WHAHIFWLRA TVYGAIAIMP KQGTPFPFPQ PYRETNIVLG EWWNNDVEEV    180
VKQGNKLGLP PNTSDAHTIN GKPGPLFPCS EKHTFAMEVE QGKTYLLRII NAALNDELFF    240
AVAGHNMTVV EIDAVYTKPF TTQAILIAPG QTTNVLVQAN QAPGRYFMAA RPFMDAPLTG    300
VYTADFPDRP PQPFNYTGAP LTANLATTSG TRLSKIAFNS TVELVLQDTN LLTVESHPFH    360
LHGYNFFVVR TGIGNFDPAK DPAKFNLVDP PERNTVGVPT GGWTAIRFRA DNPGVWFMHC    420
HLELHTGWGL KTAFVVENGK GPDQSILPPP KDLPPC*                             480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR03388ascorbase3.0e-35307444144+
TIGR03388ascorbase1.0e-4631313316+
pfam07732Cu-oxidase_31.0e-5037153119+
TIGR03389laccase4.0e-98300456157+
TIGR03389laccase1.0e-17029299271+
Gene Ontology
GO TermDescription
GO:0005507copper ion binding
GO:0016491oxidoreductase activity
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN71891.10102984292hypothetical protein [Vitis vinifera]
EMBLCAN71891.10298440399540hypothetical protein [Vitis vinifera]
RefSeqXP_002275392.10102984292PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002512915.1092994294laccase, putative [Ricinus communis]
RefSeqXP_002512915.10298456400558laccase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2hrh_A0374367462H Chain H, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome
PDB2hrg_A0374367462A Chain A, Crystal Structure Of Blue Laccase From Trametes Trogii Complexed With P-Methylbenzoate
PDB4a2h_A1.4013e-45374367462A Chain A, Crystal Structure Of Blue Laccase From Trametes Trogii Complexed With P-Methylbenzoate
PDB4a2g_A1.4013e-45374367462A Chain A, Crystal Structure Of Blue Laccase From Trametes Trogii Complexed With P-Methylbenzoate
PDB4a2e_A1.4013e-45374367462A Chain A, Crystal Structure Of Blue Laccase From Trametes Trogii Complexed With P-Methylbenzoate
Transmembrane Domains
StartEnd
729
Signal Peptide
Cleavage Site
29
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DT744390273262980
DR944266252262770
ES903109271262960
DY906648261282880
ES906241263372990
Orthologous Group
SpeciesID
Brassica rapaBra005140.25.269Bra005140.25.269Bra005698.25.285Bra005698.25.285
Carica papayaevm.model.supercontig_139.15.34.255evm.model.supercontig_139.15.34.255evm.model.supercontig_169.17.31.279evm.model.supercontig_169.17.31.279evm.model.supercontig_19.219
Citrus sinensisorange1.1g008592m.37.264orange1.1g008592m.37.264
Fragaria vescamrna25266.1-v1.0-hybrid
Glycine maxGlyma08g47410.2
Gossypium raimondiiGorai.009G103600.1.32.259Gorai.009G103600.1.32.259
Malus domesticaMDP0000192322.23.258MDP0000126274.23.271MDP0000126274.23.271MDP0000192322.23.258MDP0000226556.23.258
MDP0000226556.23.258
Panicum virgatumPavirv00001051mPavirv00052717mPavirv00016758mPavirv00052149m
Phaseolus vulgarisPhvul.008G100600.1.29.296Phvul.008G100600.1.29.296
Picea abiesMA_11289g0010MA_785232g0010MA_10433581g0010MA_21316g0010.22.258MA_21316g0010.22.258
MA_110005g0010
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny