y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.013G044300.2
FamilyGT10
Protein PropertiesLength: 363 Molecular Weight: 39760.9 Isoelectric Point: 5.135
ChromosomeChromosome/Scaffold: 13 Start: 3872280 End: 3876627
Descriptionfucosyltransferase 12
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT101373550
  TCAVGCKFGFDPRKKTDAAFGLSQEPGVATVLRSMESALYYSDNNIAQARRRGYDIVMTTSLSSDVPVGYFSWAEYDIMAPVMPKTEQALAAAFISNCGA
  RNFRLEALVGLEKANIKIDSYGGCHRNRNGKVDKVEALKRYKFSLAFENSNEEDYVTEKFFQSLVAGTIPVVVGAPNIEDFAPYPGSVLHIKELAEVQSV
  ANRMKYLAENPDAYNQSLR
Full Sequence
Protein Sequence     Length: 363     Download
MGIVSNLKGS RTQEGLPVSD GLPPSSTSVS HKKKCSNLLP LVVALVVIAE ISFLGRLDMA    60
KNAAFFDSWP DMFYKSHFSD GVAVAGVDNE IEALGGDQNG VAQNCEQWLE REDAVVYSRD    120
FSKDPIWVSG TEQEWKTCAV GCKFGFDPRK KTDAAFGLSQ EPGVATVLRS MESALYYSDN    180
NIAQARRRGY DIVMTTSLSS DVPVGYFSWA EYDIMAPVMP KTEQALAAAF ISNCGARNFR    240
LEALVGLEKA NIKIDSYGGC HRNRNGKVDK VEALKRYKFS LAFENSNEED YVTEKFFQSL    300
VAGTIPVVVG APNIEDFAPY PGSVLHIKEL AEVQSVANRM KYLAENPDAY NQSLRCSVVH    360
SP*                                                                  420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00852Glyco_transf_103.0e-32194352168+
Gene Ontology
GO TermDescription
GO:0006486protein glycosylation
GO:0008417fucosyltransferase activity
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAL99370.1013551346alpha 1,3 fucosyltransferase [Medicago sativa]
GenBankAAL99371.1013551345alpha 1,3 fucosyltransferase [Medicago sativa]
EMBLCAB52254.1013552350Fuct c3 protein [Vigna radiata var. radiata]
EMBLCAI70373.1013551362alpha 1,3 fucosyltransferase [Populus alba x Populus tremula]
RefSeqXP_002313854.1013551363predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2nzy_C0.00000004228350183304A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB2nzy_B0.00000004228350183304A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB2nzy_A0.00000004228350183304A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB2nzx_C0.00000004228350183304A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB2nzx_B0.00000004228350183304A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GR925461254483010
DW478903140481870
DW4789031351883220
HO788660282483250
CO072619256292830
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_015_00060.3Aquca_015_00060.1Aquca_015_00060.2
Arabidopsis lyrata891881891885479443
Arabidopsis thalianaAT3G19280.1AT1G49710.1
Brachypodium distachyonBradi3g38160.2Bradi3g38160.1
Brassica rapaBra014210Bra018801Bra022408
Carica papayaevm.model.supercontig_62.7
Capsella rubellaCarubv10015682mCarubv10008875m
Chlamydomonas reinhardtiig18110.t1
Citrus clementinaCiclev10028212m
Citrus sinensisorange1.1g038682m
Cucumis sativusCucsa.219830.2Cucsa.219830.1Cucsa.219830.4Cucsa.244420.1Cucsa.219830.5
Cucsa.219830.3
Eucalyptus grandisEucgr.I01147.2Eucgr.I01147.1Eucgr.I01147.3
Fragaria vescamrna28254.1-v1.0-hybrid
Glycine maxGlyma07g33580.1Glyma02g14890.1Glyma07g33580.2
Gossypium raimondiiGorai.002G008200.2Gorai.008G024900.1Gorai.013G044300.1Gorai.002G008200.1
Linum usitatissimumLus10027899Lus10014060Lus10002401Lus10019855
Malus domesticaMDP0000275804MDP0000322244
Manihot esculentacassava4.1_005385mcassava4.1_009428m
Medicago truncatulaMedtr4g086010.1
Mimulus guttatusmgv1a005269m
Oryza sativaLOC_Os08g36840.1
Panicum virgatumPavirv00032486m
Physcomitrella patensPp1s31_233V6.3Pp1s31_233V6.1
Phaseolus vulgarisPhvul.003G292000.1
Picea abiesMA_100562g0010
Populus trichocarpaPotri.009G101500.3Potri.009G101500.4Potri.009G101500.1Potri.009G101500.2
Prunus persicappa004581m
Ricinus communis29801.m003181
Setaria italicaSi013627m
Selaginella moellendorffii164166
Sorghum bicolorSb07g022980.1
Thellungiella halophilaThhalv10011402m
Vitis viniferaGSVIVT01031736001
Volvox carteriVocar20004454m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny