y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.013G076300.2
FamilyGH31
Protein PropertiesLength: 788 Molecular Weight: 88293.4 Isoelectric Point: 6.6578
ChromosomeChromosome/Scaffold: 13 Start: 9391810 End: 9396268
Descriptionalpha-xylosidase 1
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH312807710
  FYFFVGPTPLDVVDQYTSFIGRPAPMPYWSLGFHQCRWGYHNLSVVEDVVENYKKAKIPLDVIWNDDDHMDGHKDFTLNPINYPRPKLLAFLEKIHSIGM
  KYIVLIDPGIGVNSSYGVYQRAIANDVFIKYEGEPYLAQVWPGAVNFPDFLNPKTVAWWGDEIQRFHELVPVDGLWIDMNEASNFCSGKCTIPEGKQCPS
  GTGPGWECCLDCKNITKTRWDDPPYNINASGLQVPIGFKTIATSAVHYNGVLEYDAHSLYGFSQAIATHKALQGLEGKRPFILSRSTYVGSGKYAAHWTG
  DNKGTWEDLKYSISTVLNFGIFGVPMVGADICGFYPAPTEELCNRWIEVGAFYPFSRDHANYYSPRQELYQWESVTKSAQNALGMRYKLLPYLYTLTYFA
  HISGAPIARPLFFSFPAFKECHGLSTQFLLGSSLMVSPVLEQGETKVKALFPPGSWYNVFDMTQTVVSKGQYFTLDAPLHVVNVHLYQNTIL
Full Sequence
Protein Sequence     Length: 788     Download
MSFTISLLSL TLSSFRLLLV LISCFSGGYS SSSSSAAPTR IGKGYRLISI EDTSDGGFLG    60
HLQVNQKNNF YGPDIPLLQL YVKHESENRL RVHITDAEKQ RWEVPYNLLP RDQPPKPKQA    120
IGRSRKKPIS VLEIAGSELI FLHTVDPFSF AVTRRSNGQT LFNSSSGGGD SFGEMVFKDQ    180
YLEISTQLPE DASLYGLGEN TQPHGIKLYP NDPYTLYTTD VSAINLNTDL YGSHPVYMEL    240
RNVGDKPYAH AVLLLNSNGM DVFYRGNSLT YKLIGGVFDF YFFVGPTPLD VVDQYTSFIG    300
RPAPMPYWSL GFHQCRWGYH NLSVVEDVVE NYKKAKIPLD VIWNDDDHMD GHKDFTLNPI    360
NYPRPKLLAF LEKIHSIGMK YIVLIDPGIG VNSSYGVYQR AIANDVFIKY EGEPYLAQVW    420
PGAVNFPDFL NPKTVAWWGD EIQRFHELVP VDGLWIDMNE ASNFCSGKCT IPEGKQCPSG    480
TGPGWECCLD CKNITKTRWD DPPYNINASG LQVPIGFKTI ATSAVHYNGV LEYDAHSLYG    540
FSQAIATHKA LQGLEGKRPF ILSRSTYVGS GKYAAHWTGD NKGTWEDLKY SISTVLNFGI    600
FGVPMVGADI CGFYPAPTEE LCNRWIEVGA FYPFSRDHAN YYSPRQELYQ WESVTKSAQN    660
ALGMRYKLLP YLYTLTYFAH ISGAPIARPL FFSFPAFKEC HGLSTQFLLG SSLMVSPVLE    720
QGETKVKALF PPGSWYNVFD MTQTVVSKGQ YFTLDAPLHV VNVHLYQNTI LPMQQGGMIS    780
KEPLSRQ*                                                             840
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam01055Glyco_hydro_311.0e-86281468188+
cd06602GH31_MGAM_SI_GAA1.0e-86300464169+
cd06603GH31_GANC_GANAB_alpha2.0e-91300658364+
pfam01055Glyco_hydro_312.0e-95525771252+
cd06604GH31_glucosidase_II_MalA2.0e-108300683390+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAA10382.202378223785alpha-D-xylosidase [Tropaeolum majus]
RefSeqXP_002282429.10137823770PREDICTED: hypothetical protein isoform 1 [Vitis vinifera]
RefSeqXP_002311455.10307824757predicted protein [Populus trichocarpa]
RefSeqXP_002315944.10107825775predicted protein [Populus trichocarpa]
RefSeqXP_002531635.101778211777alpha-glucosidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3w38_A01378512774A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB3w37_A01378512774A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB3ctt_A05477561739A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2qmj_A05477561739A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2qly_A05477561739A Chain A, Crystral Structure Of The N-Terminal Subunit Of Human Maltase- Glucoamylase
Signal Peptide
Cleavage Site
30
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7953075212637820
HO777477523395610
CX0438282961844790
ES8187153394407780
HO777477445495920.64
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00336.5Aquca_014_00336.4Aquca_014_00336.3Aquca_014_00336.2Aquca_014_00336.1
Aquca_014_00336.6Aquca_026_00375.1Aquca_026_00374.1Aquca_026_00373.1Aquca_005_00561.8
Aquca_005_00561.7Aquca_005_00561.5Aquca_005_00561.4Aquca_005_00561.3Aquca_005_00561.2
Aquca_005_00561.1Aquca_005_00561.6Aquca_002_01146.1
Arabidopsis lyrata919683898886909139484972894626
865511862774
Arabidopsis thalianaAT5G63840.1AT3G23640.2AT3G23640.1AT5G11720.1AT3G45940.1
AT1G68560.1
Brachypodium distachyonBradi1g69780.1Bradi1g52510.1Bradi2g19280.1Bradi2g02070.1Bradi1g32650.1
Bradi2g10060.1
Brassica rapaBra024240Bra037754Bra028332Bra035407Bra004319
Bra006111Bra004031Bra028330
Carica papayaevm.model.supercontig_37.16evm.model.supercontig_1.180evm.model.supercontig_71.57evm.model.supercontig_5.162
Capsella rubellaCarubv10025824mCarubv10012876mCarubv10015582mCarubv10002711mCarubv10019747m
Chlamydomonas reinhardtiiCre03.g190500.t1.2Cre03.g194700.t1.3
Citrus clementinaCiclev10000200mCiclev10014196mCiclev10000152mCiclev10017610mCiclev10033422m
Ciclev10014274mCiclev10011016mCiclev10030449m.416.628Ciclev10030449m.416.628Ciclev10013535m
Ciclev10030449m.283.414Ciclev10030449m.283.414Ciclev10000404m.185.329Ciclev10000404m.185.329Ciclev10004303m
Citrus sinensisorange1.1g003671morange1.1g002442morange1.1g002568morange1.1g038998morange1.1g002256m
orange1.1g020492morange1.1g021825morange1.1g022976morange1.1g021612morange1.1g046216m
orange1.1g014924morange1.1g025445morange1.1g016744morange1.1g016738morange1.1g044305m
orange1.1g048354morange1.1g020723morange1.1g040705m
Cucumis sativusCucsa.228080.1Cucsa.322440.1Cucsa.236670.1Cucsa.365330.1Cucsa.283630.1
Cucsa.068450.1
Eucalyptus grandisEucgr.I00112.6Eucgr.I00112.5Eucgr.I00112.4Eucgr.I00112.3Eucgr.I00112.2
Eucgr.I00112.1Eucgr.E01212.2Eucgr.E01212.1Eucgr.K01952.1Eucgr.E01209.1
Eucgr.K01962.1Eucgr.K01954.1Eucgr.K01958.1Eucgr.L01888.1Eucgr.K01960.1
Eucgr.K01964.1Eucgr.L02199.1Eucgr.K01949.1Eucgr.G02327.1Eucgr.K01956.1
Eucgr.K01957.1Eucgr.K01953.1Eucgr.K01950.1Eucgr.L00881.1.54.343Eucgr.L00881.1.54.343
Eucgr.K01961.1Eucgr.L01889.1.188.355Eucgr.L01889.1.188.355Eucgr.L00881.1.347.493Eucgr.L00881.1.347.493
Eucgr.K01959.1Eucgr.A02235.1Eucgr.G00330.1
Fragaria vescamrna24190.1-v1.0-hybridmrna20103.1-v1.0-hybrid.273.739mrna20103.1-v1.0-hybrid.273.739mrna03754.1-v1.0-hybridmrna24638.1-v1.0-hybrid
mrna21878.1-v1.0-hybrid
Glycine maxGlyma04g38630.1Glyma06g16371.1Glyma09g03250.1Glyma15g14150.1Glyma04g14810.1
Glyma15g14140.2Glyma09g34850.1Glyma01g20460.1Glyma08g31890.1Glyma10g42140.1
Glyma15g14160.2Glyma03g28281.1
Gossypium raimondiiGorai.007G066900.6Gorai.007G066900.3Gorai.007G066900.2Gorai.007G066900.1Gorai.007G066900.4
Gorai.007G066900.5Gorai.009G115500.3Gorai.009G115500.1Gorai.005G124100.2Gorai.005G124100.1
Gorai.013G076300.1Gorai.009G115500.2Gorai.007G368700.2Gorai.007G368700.1Gorai.008G183500.2
Gorai.008G183500.1Gorai.009G115500.4Gorai.013G001500.1Gorai.013G001500.2Gorai.013G001500.3
Linum usitatissimumLus10033490Lus10020887Lus10038408Lus10008067Lus10034315
Lus10041457Lus10035020Lus10035019Lus10035671Lus10000779
Lus10000778Lus10021679Lus10031003
Malus domesticaMDP0000144090MDP0000178546MDP0000139428MDP0000894015MDP0000455477
MDP0000192721MDP0000208161MDP0000296747MDP0000169457MDP0000519142
MDP0000127634MDP0000776779MDP0000662421MDP0000238176
Manihot esculentacassava4.1_001195mcassava4.1_001191mcassava4.1_022477mcassava4.1_027331mcassava4.1_002192m
cassava4.1_001205mcassava4.1_001244mcassava4.1_001233mcassava4.1_002780mcassava4.1_006053m
cassava4.1_004250mcassava4.1_008696mcassava4.1_007575m
Medicago truncatulaMedtr3g096870.1AC235665_67.1Medtr5g026610.1Medtr5g057990.1Medtr2g031110.1.69.543
Medtr2g031110.1.69.543Medtr2g031110.1.69.543AC233660_42.1AC233660_28.1Medtr7g089780.1
Mimulus guttatusmgv1a001552mmgv1a001027mmgv1a001815mmgv1a001054mmgv1a000795m
mgv1a000741mmgv1a000940mmgv1a003100mmgv1a001294m
Oryza sativaLOC_Os03g11720.1LOC_Os06g46340.1LOC_Os06g46284.2LOC_Os06g46284.1LOC_Os07g23880.1
LOC_Os01g03950.1LOC_Os07g23944.1LOC_Os01g16310.1
Panicum virgatumPavirv00007084mPavirv00007083mPavirv00059282mPavirv00000653mPavirv00014847m
Pavirv00031858mPavirv00011190mPavirv00049442mPavirv00025581mPavirv00065694m
Pavirv00021444m
Physcomitrella patensPp1s109_267V6.2Pp1s109_267V6.1Pp1s5_330V6.1Pp1s242_48V6.1Pp1s140_141V6.1
Pp1s41_235V6.1Pp1s60_162V6.1Pp1s157_63V6.1Pp1s25_97V6.1Pp1s11_406V6.1
Pp1s80_200V6.1Pp1s86_178V6.1Pp1s13_451V6.1Pp1s264_36V6.1Pp1s264_60V6.1
Pp1s119_138V6.1Pp1s6_50V6.1Pp1s43_19V6.1Pp1s245_102V6.1Pp1s281_10V6.1
Pp1s41_238V6.1Pp1s65_69V6.1
Phaseolus vulgarisPhvul.009G153400.1Phvul.002G127000.1Phvul.006G125100.1Phvul.002G126900.1Phvul.003G035400.1
Phvul.007G026900.1Phvul.001G123000.1
Picea abiesMA_10430549g0010MA_102800g0010MA_110168g0010MA_9807255g0010MA_10426288g0010
MA_10431114g0020MA_10436707g0010MA_10431114g0010MA_10435316g0010MA_5372344g0010
Populus trichocarpaPotri.007G100000.1Potri.005G069000.1Potri.001G129600.4Potri.001G129600.2Potri.011G154200.1
Potri.011G154300.1Potri.001G129600.1Potri.011G154500.2Potri.011G154500.1Potri.001G442800.1
Potri.001G129600.3Potri.010G125800.1Potri.008G120000.2Potri.008G120000.1Potri.001G442800.2
Potri.006G039500.1Potri.001G442700.1
Prunus persicappa001032mppa001168mppa001103mppa001098mppa000927m
ppa001232m
Ricinus communis29687.m00059729827.m00260228458.m00004829776.m00046827524.m000301
29733.m00074634899.m00001952272.m000013
Setaria italicaSi034132mSi005827mSi028815mSi000221mSi000237m
Selaginella moellendorffii142083923397985582321
Sorghum bicolorSb01g042750.1Sb10g027110.1Sb03g007230.1Sb02g010060.1.193.392Sb02g010060.1.193.392
Sb02g010060.1.393.531Sb02g010060.1.393.531Sb03g010640.1.716.836Sb03g010640.1.716.836Sb03g010640.1.427.700
Sb03g010640.1.427.700
Thellungiella halophilaThhalv10003620mThhalv10019990mThhalv10019989mThhalv10012616mThhalv10012743m
Thhalv10018167mThhalv10018090m
Vitis viniferaGSVIVT01020935001GSVIVT01024287001GSVIVT01022815001GSVIVT01037959001.254.722GSVIVT01037959001.254.722
GSVIVT01011904001GSVIVT01036946001GSVIVT01033641001
Volvox carteriVocar20005557m
Zea maysAC203753.4_FGT006
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)