y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.013G092200.2
FamilyGT35
Protein PropertiesLength: 769 Molecular Weight: 87754.8 Isoelectric Point: 4.8797
ChromosomeChromosome/Scaffold: 13 Start: 14807197 End: 14813532
DescriptionGlycosyl transferase, family 35
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT351627600
  ALKKLGHNLEDVAREEPDAALGNGGLGRLASCFLDSLATLNYPAWGYGLRYKYGLFKQYITKDGQEEVAENWLEMGNPWEIVRNDVSYPVKFYGEVISGP
  EGIKEWVGGEDITAVAYDVPIPGYKTKTTINLRLWSTKVAPEKFDLSAFNAGDHAKAYSAMNNAEKICYILYPGDESLEGKTLRLKQQYTLCSASLQDII
  ARYERRSGEFLNWEIFPEKVAVQMNDTHPTLCIPELIRILIDVKGLSWEQAWNITQRTVAYTNHTVLPEALEKWSLELMEKLLPRHVEIIKMIDEELVQT
  IIDEYGTEDLDLLQEKLKQMRILDNIELPESVVEMIAKPEKSLVEAIESTEEDDVSDEETEPTAEEDELEEEEIEEENEVPPIIEPDPKLPKLVRMANLC
  VAGGYAVNGVAEIHSEIVKNEVFNDFYEMWPEKFQNKTNGVTPRRWIRFCNPDLSKIITKWTGSEDWVVNTEKLLTLRKFSDNEDLQSEWREAKRRNKVK
  VASFLREKTGYIVNPDAMFDVQVKRIHEYKRQLLNIMGIVYRYKKMKGMSHEERKASFAPRVCIFGGKAFATYVQAKRIVKFITDVGATVNHDPEIGDL
Full Sequence
Protein Sequence     Length: 769     Download
MASLPFSATS FHSTFICFNY KARNPNLFFL KKGSSFTFSR RKFIIKSVAS DQRQDLKEEG    60
QITEEASLDT FVPDSASVAS SIKYHSEFTP SFAPDHFELP KAFKATAESV RDSLIINWNA    120
TYAYYEKINV KQAYYLSMEY LQGRALLNAI GNLELTGAYA EALKKLGHNL EDVAREEPDA    180
ALGNGGLGRL ASCFLDSLAT LNYPAWGYGL RYKYGLFKQY ITKDGQEEVA ENWLEMGNPW    240
EIVRNDVSYP VKFYGEVISG PEGIKEWVGG EDITAVAYDV PIPGYKTKTT INLRLWSTKV    300
APEKFDLSAF NAGDHAKAYS AMNNAEKICY ILYPGDESLE GKTLRLKQQY TLCSASLQDI    360
IARYERRSGE FLNWEIFPEK VAVQMNDTHP TLCIPELIRI LIDVKGLSWE QAWNITQRTV    420
AYTNHTVLPE ALEKWSLELM EKLLPRHVEI IKMIDEELVQ TIIDEYGTED LDLLQEKLKQ    480
MRILDNIELP ESVVEMIAKP EKSLVEAIES TEEDDVSDEE TEPTAEEDEL EEEEIEEENE    540
VPPIIEPDPK LPKLVRMANL CVAGGYAVNG VAEIHSEIVK NEVFNDFYEM WPEKFQNKTN    600
GVTPRRWIRF CNPDLSKIIT KWTGSEDWVV NTEKLLTLRK FSDNEDLQSE WREAKRRNKV    660
KVASFLREKT GYIVNPDAMF DVQVKRIHEY KRQLLNIMGI VYRYKKMKGM SHEERKASFA    720
PRVCIFGGKA FATYVQAKRI VKFITDVGAT VNHDPEIGDL LKYGRNGG*                780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR02093P_ylase1.0e-93553762210+
cd04300GT1_Glycogen_Phosphorylase4.0e-107552762211+
pfam00343Phosphorylase3.0e-136162496335+
TIGR02093P_ylase6.0e-17182486408+
cd04300GT1_Glycogen_Phosphorylase079496422+
Gene Ontology
GO TermDescription
GO:0004645phosphorylase activity
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI27267.1017621740unnamed protein product [Vitis vinifera]
Swiss-ProtP5353503276225781PHSL2_SOLTU RecName: Full=Alpha-1,4 glucan phosphorylase L-2 isozyme, chloroplastic/amyloplastic; AltName: Full=Starch phosphorylase L-2; Flags: Precursor
RefSeqXP_002274575.1017621788PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002316098.1017621760predicted protein [Populus trichocarpa]
RefSeqXP_002512108.1017621780glycogen phosphorylase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1z8d_A010576255642A Chain A, Crystal Structure Of Human Muscle Glycogen Phosphorylase A With Amp And Glucose
PDB2ffr_A010576243630A Chain A, Crystallographic Studies On N-Azido-Beta-D-Glucopyranosylamine, An Inhibitor Of Glycogen Phosphorylase: Comparison With N-Acetyl-Beta-D- Glucopyranosylam
PDB2gj4_A010576243630A Chain A, Structure Of Rabbit Muscle Glycogen Phosphorylase In Complex With Ligand
PDB4el5_A010576243630A Chain A, Structure Of Rabbit Muscle Glycogen Phosphorylase In Complex With Ligand
PDB4el0_A010576243630A Chain A, Structure Of Rabbit Muscle Glycogen Phosphorylase In Complex With Ligand
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7783034021025030
HO7783032075567620
CO1001372971934890
ES8165573261775020
HO77830387201030.000000002
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00755.3Aquca_009_00755.2Aquca_009_00755.1Aquca_002_00786.1Aquca_002_00786.2
Arabidopsis lyrata485074323006
Arabidopsis thalianaAT3G46970.1AT3G29320.1
Brachypodium distachyonBradi2g55120.1Bradi1g08070.1.569.972Bradi1g08070.1.569.972Bradi1g08070.1.163.525Bradi1g08070.1.163.525
Brassica rapaBra018180Bra025392Bra033098
Carica papayaevm.model.supercontig_27.5evm.model.supercontig_112.64.358.739evm.model.supercontig_112.64.358.739evm.model.supercontig_14.158evm.model.supercontig_112.64.117.357
evm.model.supercontig_112.64.117.357
Capsella rubellaCarubv10019408mCarubv10016634m
Chlamydomonas reinhardtiiCre12.g552200.t1.2Cre07.g336950.t1.1
Citrus clementinaCiclev10027815mCiclev10027813mCiclev10010975m.585.995Ciclev10010975m.585.995Ciclev10010975m.176.514
Ciclev10010975m.176.514
Citrus sinensisorange1.1g004485morange1.1g003202morange1.1g003197morange1.1g003196morange1.1g003188m
orange1.1g003186morange1.1g005595morange1.1g003693morange1.1g003742morange1.1g004697m
orange1.1g004696morange1.1g007597morange1.1g003875m.374.784orange1.1g003875m.374.784orange1.1g003079m.434.844
orange1.1g003079m.434.844orange1.1g003074m.434.844orange1.1g003074m.434.844orange1.1g003072m.434.844orange1.1g003072m.434.844
orange1.1g003055m.436.846orange1.1g003055m.436.846orange1.1g001879m.585.995orange1.1g001879m.585.995orange1.1g009651m
orange1.1g002111morange1.1g012447morange1.1g005402m.400.692orange1.1g005402m.400.692orange1.1g005402m.25.349
orange1.1g005402m.25.349orange1.1g003079m.25.349orange1.1g003079m.25.349orange1.1g003074m.25.349orange1.1g003074m.25.349
orange1.1g003072m.25.349orange1.1g003072m.25.349orange1.1g001879m.176.500orange1.1g001879m.176.500orange1.1g003055m.25.351
orange1.1g003055m.25.351orange1.1g026345m
Cucumis sativusCucsa.126920.10Cucsa.126920.1Cucsa.139040.4Cucsa.139040.3Cucsa.139040.2
Cucsa.139040.1Cucsa.284600.1Cucsa.273090.1
Eucalyptus grandisEucgr.B02278.2Eucgr.B02278.1Eucgr.B03166.3Eucgr.B03166.2Eucgr.J01374.1
Eucgr.B03166.1Eucgr.B03166.5Eucgr.B03166.4
Fragaria vescamrna29749.1-v1.0-hybridmrna07968.1-v1.0-hybridmrna04322.1-v1.0-hybrid.157.481mrna04322.1-v1.0-hybrid.157.481
Glycine maxGlyma13g30920.2Glyma13g30920.3Glyma08g45210.1Glyma18g07480.1Glyma20g03250.4.554.965
Glyma20g03250.4.554.965Glyma20g03250.3.562.973Glyma20g03250.3.562.973Glyma20g03250.2.562.973Glyma20g03250.2.562.973
Glyma13g06040.1Glyma19g03490.1Glyma20g03250.4.161.485Glyma20g03250.4.161.485Glyma20g03250.3.169.493
Glyma20g03250.3.169.493Glyma20g03250.2.169.493Glyma20g03250.2.169.493
Gossypium raimondiiGorai.009G166800.1Gorai.013G260900.2Gorai.013G260900.1Gorai.013G260900.3Gorai.006G011500.7.330.728
Gorai.006G011500.7.330.728Gorai.006G011500.4.514.912Gorai.006G011500.4.514.912Gorai.006G011500.3.580.978Gorai.006G011500.3.580.978
Gorai.006G011500.2.583.981Gorai.006G011500.2.583.981Gorai.006G011500.1.583.986Gorai.006G011500.1.583.986Gorai.013G092200.1
Gorai.006G011500.6.177.501Gorai.006G011500.6.177.501Gorai.006G011500.5.180.504Gorai.006G011500.5.180.504Gorai.006G011500.4.111.435
Gorai.006G011500.4.111.435Gorai.006G011500.3.177.501Gorai.006G011500.3.177.501Gorai.006G011500.2.180.504Gorai.006G011500.2.180.504
Gorai.006G011500.1.180.504Gorai.006G011500.1.180.504Gorai.006G011500.6.580.815Gorai.006G011500.6.580.815Gorai.006G011500.5.583.818
Gorai.006G011500.5.583.818
Linum usitatissimumLus10036892Lus10042688Lus10037093Lus10029643Lus10029644
Malus domesticaMDP0000288190MDP0000123354MDP0000266061MDP0000129346.602.999MDP0000129346.602.999
MDP0000145828MDP0000128518MDP0000778598MDP0000259799MDP0000129346.170.509
MDP0000129346.170.509MDP0000211642
Manihot esculentacassava4.1_001626mcassava4.1_002082mcassava4.1_024481mcassava4.1_002466mcassava4.1_002614m.310.707
cassava4.1_002614m.310.707cassava4.1_001096mcassava4.1_025456mcassava4.1_007176mcassava4.1_004717m.211.560
cassava4.1_004717m.211.560cassava4.1_002614m.25.217cassava4.1_002614m.25.217cassava4.1_004717m.25.195cassava4.1_004717m.25.195
cassava4.1_009211m
Medicago truncatulaMedtr2g014460.1Medtr6g014480.1Medtr4g082950.1.578.876Medtr4g082950.1.578.876Medtr4g082950.1.170.494
Medtr4g082950.1.170.494Medtr6g014480.2
Mimulus guttatusmgv1a000698mmgv1a001277mmgv1a000878mmgv1a002586mmgv1a002585m
Oryza sativaLOC_Os01g63270.1LOC_Os01g63270.2LOC_Os03g55090.1
Panicum virgatumPavirv00009874mPavirv00050649mPavirv00050650mPavirv00004990m.515.914Pavirv00004990m.515.914
Pavirv00034922m.529.918Pavirv00034922m.529.918Pavirv00034922m.119.465Pavirv00034922m.119.465Pavirv00004990m.97.438
Pavirv00004990m.97.438
Physcomitrella patensPp1s30_182V6.1Pp1s180_124V6.1Pp1s86_213V6.1Pp1s195_41V6.1Pp1s53_212V6.1.566.981
Pp1s53_212V6.1.566.981Pp1s53_212V6.1.179.499Pp1s53_212V6.1.179.499
Phaseolus vulgarisPhvul.006G182300.1Phvul.006G064100.1Phvul.002G168400.1.570.971Phvul.002G168400.1.570.971Phvul.004G034400.1.582.980
Phvul.004G034400.1.582.980Phvul.002G168400.1.169.519Phvul.002G168400.1.169.519Phvul.004G034400.1.180.504Phvul.004G034400.1.180.504
Picea abiesMA_10437129g0010MA_14581g0010MA_10428980g0010
Populus trichocarpaPotri.004G048600.1Potri.004G048600.2Potri.009G041800.1Potri.009G041800.3Potri.010G160200.2
Potri.009G041800.4Potri.009G041800.2.126.655Potri.009G041800.2.126.655Potri.004G123600.5Potri.010G160200.5
Potri.010G160200.1Potri.010G160200.7Potri.010G160200.4Potri.010G160200.3Potri.004G123600.4.176.534
Potri.004G123600.4.176.534Potri.004G123600.3.176.534Potri.004G123600.3.176.534Potri.004G123600.2.176.534Potri.004G123600.2.176.534
Potri.004G123600.1.176.533Potri.004G123600.1.176.533Potri.010G160200.6Potri.009G041800.2.660.825Potri.009G041800.2.660.825
Prunus persicappa000587mppa001354mppa000958mppa000827m.586.983ppa000827m.586.983
ppa000827m.171.506ppa000827m.171.506
Ricinus communis29751.m00179630190.m011310.461.94330190.m011310.461.94330174.m00913629630.m000793
30190.m011310.264.44430190.m011310.264.444
Setaria italicaSi000306mSi034019m
Selaginella moellendorffii148158164611184206
Sorghum bicolorSb03g040060.1Sb01g007560.2.550.949Sb01g007560.2.550.949Sb01g007560.1.580.979Sb01g007560.1.580.979
Sb01g007560.2.140.492Sb01g007560.2.140.492Sb01g007560.1.170.522Sb01g007560.1.170.522
Thellungiella halophilaThhalv10010122mThhalv10003599m
Vitis viniferaGSVIVT01021111001GSVIVT01024804001GSVIVT01012194001GSVIVT01011504001.577.977GSVIVT01011504001.577.977
GSVIVT01011504001.177.501GSVIVT01011504001.177.501
Volvox carteriVocar20006426mVocar20001423m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)