y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.013G167400.2
FamilyGH1
Protein PropertiesLength: 515 Molecular Weight: 58590.6 Isoelectric Point: 7.2485
ChromosomeChromosome/Scaffold: 13 Start: 45177705 End: 45184096
Descriptionbeta-glucosidase 47
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1244760
  VEGGYLEDGKGLSNWDVFTHIPGNIKNNENGDDADDDYHLFLEDAEIAQSLGVNAYRFSISWARILPRGRFGEVNPGGIKFYNKIIDNLLLRGIEPFLTI
  HHFDLPQELEDRYGAWLSPLMQDDFLLLAETCFKSFGDRVKYWTTINEPNVFAEMSYVRGLYPPAHCSPPFGNCSVGNADIEPLIVVHNMLLAHGKAVKL
  YRERFQSKQGGSIGLVVQSHMYEPLRDVESDRQAVNRALAFTGGWVLDPLVFGDYPPEMRQYHRSELPRFSSEETEYMKGSIDFIGLNHYSTLYAKDCIH
  SPCVLGGDHFIRGFTFTTGERDGTLIGEPTGVERFYVVPRGMEKIVDHVSKRYNNMPIYVTENGYCPPLTEAAPNLLHDVNRVHFYNGYLAALARAIRKG
  ADVRGYFAWSLMDNFEWAGGYSSTFGLYYVDRLTMNRTPKLSAKWFQHFLANR
Full Sequence
Protein Sequence     Length: 515     Download
MLKVLRLKAK MLEDLNSQIT FCLVEGGYLE DGKGLSNWDV FTHIPGNIKN NENGDDADDD    60
YHLFLEDAEI AQSLGVNAYR FSISWARILP RGRFGEVNPG GIKFYNKIID NLLLRGIEPF    120
LTIHHFDLPQ ELEDRYGAWL SPLMQDDFLL LAETCFKSFG DRVKYWTTIN EPNVFAEMSY    180
VRGLYPPAHC SPPFGNCSVG NADIEPLIVV HNMLLAHGKA VKLYRERFQS KQGGSIGLVV    240
QSHMYEPLRD VESDRQAVNR ALAFTGGWVL DPLVFGDYPP EMRQYHRSEL PRFSSEETEY    300
MKGSIDFIGL NHYSTLYAKD CIHSPCVLGG DHFIRGFTFT TGERDGTLIG EPTGVERFYV    360
VPRGMEKIVD HVSKRYNNMP IYVTENGYCP PLTEAAPNLL HDVNRVHFYN GYLAALARAI    420
RKGADVRGYF AWSLMDNFEW AGGYSSTFGL YYVDRLTMNR TPKLSAKWFQ HFLANRSSAR    480
FNRQRFVNPT PKSRRVRKSK YIVIATTNAN ATDV*                               540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02849PLN028492.0e-12825478456+
PLN02998PLN029983.0e-13224473453+
PLN02814PLN028145.0e-13325473455+
TIGR03356BGL9.0e-14224469447+
pfam00232Glyco_hydro_18.0e-15924475456+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI20347.102449648519unnamed protein product [Vitis vinifera]
Swiss-ProtQ7XSK002447547500BGL18_ORYSJ RecName: Full=Beta-glucosidase 18; Short=Os4bglu18; Flags: Precursor
RefSeqXP_002281979.102449695566PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002281986.102447551504PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002329151.102447319469predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3gnr_A02547333486A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB3gnp_A02547333486A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB3gno_A02547333486A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB2rgm_B02447335479A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB2rgm_A02447335479A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
ES8034122592575150
DW47908523662410
DW47890524562500
DY975826287413270
DY965900303243260
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_012_00117.1Aquca_054_00059.1Aquca_054_00064.2Aquca_054_00061.2Aquca_054_00061.1
Aquca_054_00064.3Aquca_054_00064.1.216.582Aquca_054_00064.1.216.582Aquca_054_00060.1Aquca_054_00064.4
Aquca_054_00061.3Aquca_054_00061.4Aquca_054_00061.5Aquca_054_00061.6
Arabidopsis lyrata475147492699475148
Arabidopsis thalianaAT1G61820.1AT4G21760.1AT1G61810.1AT1G61810.3AT1G61820.3
Brachypodium distachyonBradi5g15540.1Bradi5g15527.1Bradi5g15540.3Bradi5g15540.2
Brassica rapaBra028383Bra031392Bra038756Bra013557Bra038755
Carica papayaevm.model.supercontig_198.21
Capsella rubellaCarubv10021428mCarubv10020143mCarubv10021331mCarubv10006876m
Citrus clementinaCiclev10007996mCiclev10014887mCiclev10017801m
Citrus sinensisorange1.1g009535morange1.1g014339morange1.1g045534morange1.1g016308morange1.1g012716m
orange1.1g016444morange1.1g016438morange1.1g022079m
Cucumis sativusCucsa.341820.2Cucsa.341820.1Cucsa.123340.1Cucsa.086000.1Cucsa.341820.3
Cucsa.341810.1
Eucalyptus grandisEucgr.H00071.1Eucgr.H02855.1Eucgr.E04103.1Eucgr.H02856.1Eucgr.H02856.2
Fragaria vescamrna19575.1-v1.0-hybrid
Glycine maxGlyma15g11290.2Glyma13g35430.2Glyma12g35125.1Glyma07g38840.1Glyma07g38850.1
Glyma12g35140.2Glyma13g35410.2Glyma13g35410.3Glyma13g35410.4
Gossypium raimondiiGorai.010G178500.1Gorai.010G178800.1Gorai.013G167400.1Gorai.013G167400.4Gorai.011G016100.1.462.724
Gorai.011G016100.1.462.724Gorai.013G167400.5Gorai.013G167400.3.150.447Gorai.013G167400.3.150.447Gorai.013G167400.6
Linum usitatissimumLus10018353Lus10007656Lus10007655Lus10032660Lus10018354
Lus10032659
Malus domesticaMDP0000140817MDP0000213598MDP0000306738MDP0000149337
Manihot esculentacassava4.1_005677mcassava4.1_032622mcassava4.1_031147mcassava4.1_026351m
Medicago truncatulaMedtr4g131800.1Medtr4g131810.1
Mimulus guttatusmgv1a004080m
Oryza sativaLOC_Os04g43360.1LOC_Os04g43410.1LOC_Os04g43390.2LOC_Os04g43360.2LOC_Os04g43390.1
LOC_Os04g43400.1LOC_Os04g43380.1
Panicum virgatumPavirv00042435mPavirv00070823mPavirv00006566mPavirv00021804mPavirv00059033m
Pavirv00006565mPavirv00036311mPavirv00010790m
Physcomitrella patensPp1s22_312V6.2Pp1s22_312V6.1
Phaseolus vulgarisPhvul.005G082900.1Phvul.005G082800.3Phvul.005G082800.2Phvul.005G082800.1Phvul.007G273800.1
Phvul.003G076700.1Phvul.006G151300.1Phvul.003G076800.1Phvul.006G151400.1Phvul.003G076700.2
Picea abiesMA_10431526g0010MA_119280g0010
Populus trichocarpaPotri.004G019800.1Potri.004G019700.1Potri.004G019500.1Potri.004G019300.1Potri.004G019300.2
Potri.001G403900.1Potri.004G019400.1
Prunus persicappa004523mppa025660mppa005194mppa017816m
Ricinus communis29842.m00362929904.m002964
Setaria italicaSi009837mSi009886mSi009882mSi009894mSi009871m
Si009850mSi010127mSi010115mSi010284mSi010346m
Si010332mSi010833m
Sorghum bicolorSb06g022460.1Sb06g022450.1Sb06g022510.1Sb06g022500.1Sb06g022410.1
Sb06g022490.1Sb06g022420.1Sb06g022385.1
Thellungiella halophilaThhalv10024134mThhalv10024920mThhalv10024911mThhalv10023411mThhalv10024896m
Vitis viniferaGSVIVT01014400001GSVIVT01012650001GSVIVT01014399001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)