y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.013G167400.6
FamilyGH1
Protein PropertiesLength: 301 Molecular Weight: 33944.3 Isoelectric Point: 4.6766
ChromosomeChromosome/Scaffold: 13 Start: 45177705 End: 45179357
Descriptionbeta-glucosidase 45
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1393000
  FEFPDNFLFGTAVSSYQVEGGYLEDGKGLSNWDVFTHIPGNIKNNENGDDADDDYHLFLEDAEIAQSLGVNAYRFSISWARILPRGRFGEVNPGGIKFYN
  KIIDNLLLRGIEPFLTIHHFDLPQELEDRYGAWLSPLMQDDFLLLAETCFKSFGDRVKYWTTINEPNVFAEMSYVRGLYPPAHCSPPFGNCSVGNADIEP
  LIVVHNMLLAHGKAVKLYRERFQSKQGGSIGLVVQSHMYEPLRDVESDRQAVNRALAFTGGW
Full Sequence
Protein Sequence     Length: 301     Download
MPVNDIIHVS LMFFVVYLLV SSTSNAEGFE IESQDVRRFE FPDNFLFGTA VSSYQVEGGY    60
LEDGKGLSNW DVFTHIPGNI KNNENGDDAD DDYHLFLEDA EIAQSLGVNA YRFSISWARI    120
LPRGRFGEVN PGGIKFYNKI IDNLLLRGIE PFLTIHHFDL PQELEDRYGA WLSPLMQDDF    180
LLLAETCFKS FGDRVKYWTT INEPNVFAEM SYVRGLYPPA HCSPPFGNCS VGNADIEPLI    240
VVHNMLLAHG KAVKLYRERF QSKQGGSIGL VVQSHMYEPL RDVESDRQAV NRALAFTGGW    300
*                                                                    360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02814PLN028146.0e-878300294+
PLN02998PLN029984.0e-8710300292+
COG2723BglB3.0e-8841296259+
TIGR03356BGL3.0e-8942300260+
pfam00232Glyco_hydro_15.0e-10338300264+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI20347.1013001292unnamed protein product [Vitis vinifera]
RefSeqXP_002281979.102930068339PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002281986.104130036295PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002329151.10383001263predicted protein [Populus trichocarpa]
RefSeqXP_002448173.1093006288hypothetical protein SORBIDRAFT_06g022450 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3gnr_A03630012276A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB3gnp_A03630012276A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB3gno_A03630012276A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB3scq_B03630015275A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB3scq_A03630015275A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
Signal Peptide
Cleavage Site
26
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DW479085218562730
DW478905227562820
DY291078287163000
DW4790853217480.000000003
DW4789053217480.000000003
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_012_00117.1Aquca_054_00059.1Aquca_054_00064.2Aquca_054_00061.2Aquca_054_00061.1
Aquca_054_00064.3Aquca_054_00064.1.216.582Aquca_054_00064.1.216.582Aquca_054_00060.1Aquca_054_00064.4
Aquca_054_00061.3Aquca_054_00061.4Aquca_054_00061.5Aquca_054_00061.6
Arabidopsis lyrata475147492699475148
Arabidopsis thalianaAT1G61820.1AT4G21760.1AT1G61810.1AT1G61810.3AT1G61820.3
Brachypodium distachyonBradi5g15540.1Bradi5g15527.1Bradi5g15540.3Bradi5g15540.2
Brassica rapaBra028383Bra031392Bra038756Bra013557Bra038755
Carica papayaevm.model.supercontig_198.21
Capsella rubellaCarubv10021428mCarubv10020143mCarubv10021331mCarubv10006876m
Citrus clementinaCiclev10007996mCiclev10014887mCiclev10017801m
Citrus sinensisorange1.1g009535morange1.1g014339morange1.1g045534morange1.1g016308morange1.1g012716m
orange1.1g016444morange1.1g016438morange1.1g022079m
Cucumis sativusCucsa.341820.2Cucsa.341820.1Cucsa.123340.1Cucsa.086000.1Cucsa.341820.3
Cucsa.341810.1
Eucalyptus grandisEucgr.H00071.1Eucgr.H02855.1Eucgr.E04103.1Eucgr.H02856.1Eucgr.H02856.2
Fragaria vescamrna19575.1-v1.0-hybrid
Glycine maxGlyma15g11290.2Glyma13g35430.2Glyma12g35125.1Glyma07g38840.1Glyma07g38850.1
Glyma12g35140.2Glyma13g35410.2Glyma13g35410.3Glyma13g35410.4
Gossypium raimondiiGorai.010G178500.1Gorai.010G178800.1Gorai.013G167400.1Gorai.013G167400.2Gorai.013G167400.4
Gorai.011G016100.1.462.724Gorai.011G016100.1.462.724Gorai.013G167400.5Gorai.013G167400.3.150.447Gorai.013G167400.3.150.447
Linum usitatissimumLus10018353Lus10007656Lus10007655Lus10032660Lus10018354
Lus10032659
Malus domesticaMDP0000140817MDP0000213598MDP0000306738MDP0000149337
Manihot esculentacassava4.1_005677mcassava4.1_032622mcassava4.1_031147mcassava4.1_026351m
Medicago truncatulaMedtr4g131800.1Medtr4g131810.1
Mimulus guttatusmgv1a004080m
Oryza sativaLOC_Os04g43360.1LOC_Os04g43410.1LOC_Os04g43390.2LOC_Os04g43360.2LOC_Os04g43390.1
LOC_Os04g43400.1LOC_Os04g43380.1
Panicum virgatumPavirv00042435mPavirv00070823mPavirv00006566mPavirv00021804mPavirv00059033m
Pavirv00006565mPavirv00036311mPavirv00010790m
Physcomitrella patensPp1s22_312V6.2Pp1s22_312V6.1
Phaseolus vulgarisPhvul.005G082900.1Phvul.005G082800.3Phvul.005G082800.2Phvul.005G082800.1Phvul.007G273800.1
Phvul.003G076700.1Phvul.006G151300.1Phvul.003G076800.1Phvul.006G151400.1Phvul.003G076700.2
Picea abiesMA_10431526g0010MA_119280g0010
Populus trichocarpaPotri.004G019800.1Potri.004G019700.1Potri.004G019500.1Potri.004G019300.1Potri.004G019300.2
Potri.001G403900.1Potri.004G019400.1
Prunus persicappa004523mppa025660mppa005194mppa017816m
Ricinus communis29842.m00362929904.m002964
Setaria italicaSi009837mSi009886mSi009882mSi009894mSi009871m
Si009850mSi010127mSi010115mSi010284mSi010346m
Si010332mSi010833m
Sorghum bicolorSb06g022460.1Sb06g022450.1Sb06g022510.1Sb06g022500.1Sb06g022410.1
Sb06g022490.1Sb06g022420.1Sb06g022385.1
Thellungiella halophilaThhalv10024134mThhalv10024920mThhalv10024911mThhalv10023411mThhalv10024896m
Vitis viniferaGSVIVT01014400001GSVIVT01012650001GSVIVT01014399001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)