y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.013G173400.1
FamilyGT22
Protein PropertiesLength: 580 Molecular Weight: 65522.8 Isoelectric Point: 7.9326
ChromosomeChromosome/Scaffold: 13 Start: 46135535 End: 46140018
DescriptionAlg9-like mannosyltransferase family
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT22574580
  FALGMLRYMSATSNIIHDCDEVFNYWEPLHYLLYKSGFQTWEYSSEFALRSYLYIIFHELVGRPASWLFAEEKVRVFYAVRLFLGFLSLISDATLVVALS
  RKYGKRLASYALAMLCLASGCFFASTSFLPSSFSMYAMSLSSGLFLLEKPAWAVAVAAVGVILGWPFSILAFLPLTFYSLAKQFKQAFLSGAVTSIALLA
  LSILVDHCYYQRWTSSVFNLLVYNVLGGGESHLYGTEGPLFYIRNGFNNFNFCFILALLFLGILPIARKKYAPDLLIVISPLYIWLAFMSLQPHKEERFL
  YPIYPLVCVAASAVIESFPDLFRDKYNPYDNSIIVMMAKFLRPVALSLILCASHSRTFSLINGYAAPMEVYKILEHHDDAGSGSVLCVGSEWHRYPSSFF
  VP
Full Sequence
Protein Sequence     Length: 580     Download
MSFSTRQRRA TVSDLPSSSS PSQPSTPESY TKVDKPGRSS SDGVGEDRGL GWFTVLFALG    60
MLRYMSATSN IIHDCDEVFN YWEPLHYLLY KSGFQTWEYS SEFALRSYLY IIFHELVGRP    120
ASWLFAEEKV RVFYAVRLFL GFLSLISDAT LVVALSRKYG KRLASYALAM LCLASGCFFA    180
STSFLPSSFS MYAMSLSSGL FLLEKPAWAV AVAAVGVILG WPFSILAFLP LTFYSLAKQF    240
KQAFLSGAVT SIALLALSIL VDHCYYQRWT SSVFNLLVYN VLGGGESHLY GTEGPLFYIR    300
NGFNNFNFCF ILALLFLGIL PIARKKYAPD LLIVISPLYI WLAFMSLQPH KEERFLYPIY    360
PLVCVAASAV IESFPDLFRD KYNPYDNSII VMMAKFLRPV ALSLILCASH SRTFSLINGY    420
AAPMEVYKIL EHHDDAGSGS VLCVGSEWHR YPSSFFVPDY IGEVRWIDDG FRGLLPFPFN    480
DTLGGTAAAP PYFNNKNKAS DEQYLRDIEA CTFLVELQLN RPFPYRGNDL SAWEPIAALP    540
YLDRELSPAK YRSFFIPYLW QEKNVFGMYK LLKRVSKPE*                          600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02816PLN028160.000476365306+
pfam03901Glyco_transf_226.0e-9254458432+
Gene Ontology
GO TermDescription
GO:0006506GPI anchor biosynthetic process
GO:0016757transferase activity, transferring glycosyl groups
GO:0031227intrinsic to endoplasmic reticulum membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN72375.1015771570hypothetical protein [Vitis vinifera]
RefSeqNP_173134.2045775570sugar binding / transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqXP_002285438.1015771570PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002316862.1055771566predicted protein [Populus trichocarpa]
RefSeqXP_002523375.1015751567glycosyltransferase, putative [Ricinus communis]
Transmembrane Domains
StartEnd
134156
163185
209231
244266
297319
331348
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO1166812292424700
GT0350883352255580
EL453002308613640
EC3655242942755680
AI7284492133185300
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_021_00239.3Aquca_021_00239.2Aquca_021_00239.1
Arabidopsis lyrata471892
Arabidopsis thalianaAT1G16900.1
Brachypodium distachyonBradi2g06627.1Bradi2g06627.2
Brassica rapaBra016625Bra026017
Carica papayaevm.model.supercontig_97.103
Capsella rubellaCarubv10008988mCarubv10008626m
Citrus clementinaCiclev10019496m
Citrus sinensisorange1.1g009200morange1.1g008307m
Cucumis sativusCucsa.057600.1
Eucalyptus grandisEucgr.F01228.1
Fragaria vescamrna27242.1-v1.0-hybrid
Glycine maxGlyma13g34570.2Glyma12g35831.2Glyma12g35831.1Glyma13g34570.1
Linum usitatissimumLus10028153Lus10042853
Malus domesticaMDP0000250399MDP0000193605
Manihot esculentacassava4.1_004544m
Medicago truncatulaMedtr2g076680.1
Mimulus guttatusmgv1a003735m
Oryza sativaLOC_Os01g11070.1
Panicum virgatumPavirv00044939m
Physcomitrella patensPp1s478_15V6.1
Phaseolus vulgarisPhvul.005G066500.1
Picea abiesMA_10429532g0010
Populus trichocarpaPotri.011G110800.1Potri.011G110800.2Potri.011G110800.3
Prunus persicappa003475m
Ricinus communis28842.m000906
Setaria italicaSi000820m
Selaginella moellendorffii442454
Sorghum bicolorSb03g002210.1
Thellungiella halophilaThhalv10007218m
Vitis viniferaGSVIVT01014208001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny