y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.013G221800.2
FamilyCE8
Protein PropertiesLength: 396 Molecular Weight: 43194.2 Isoelectric Point: 8.4594
ChromosomeChromosome/Scaffold: 13 Start: 54174451 End: 54176280
DescriptionPlant invertase/pectin methylesterase inhibitor superfamily
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE82153950
  VTVAVDGTGNFSTIGDAIRFAPNKSKERVMIYVREGVYEENVVIPSCKTNIVLIGDGSEVTFITGNRSVVDGWTTFRSATLAVSGEGFLARDITIQNRAG
  PEKHQAVALRVSADLAAFYRCTFNGYQDTLYVHSFRQFYRECNISGTIDYIFGNAAAVFQACNIISRMPMPGQFTVITAQS
Full Sequence
Protein Sequence     Length: 396     Download
MASSSKAISI LFITIFFSST LGLNISSTNS LSPNLTSIQS ICQSTPYPDS CFDSLKLSIS    60
INISPDILTY LLQTLHTALS EATKLTNLFS NGGNSNDIVE KQRGTLQDCK ELHETTLSIL    120
EKTVSSIKDG DSKKLADARV YLSAALTNKN TCLEGLDSAL GPLKPVMVKS LIGTYKHVSN    180
SLSMLPKLGK RHRNRRLSCR VLRGVDDEYN PREVVTVAVD GTGNFSTIGD AIRFAPNKSK    240
ERVMIYVREG VYEENVVIPS CKTNIVLIGD GSEVTFITGN RSVVDGWTTF RSATLAVSGE    300
GFLARDITIQ NRAGPEKHQA VALRVSADLA AFYRCTFNGY QDTLYVHSFR QFYRECNISG    360
TIDYIFGNAA AVFQACNIIS RMPMPGQFTV ITAQS*                              420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN03043PLN030434.0e-9842394410+
PLN02314PLN023143.0e-10239395394+
PLN02713PLN027132.0e-10640394406+
pfam01095Pectinesterase5.0e-117215395181+
PLN02416PLN02416040395370+
Gene Ontology
GO TermDescription
GO:0004857enzyme inhibitor activity
GO:0005618cell wall
GO:0030599pectinesterase activity
GO:0042545cell wall modification
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAH56489.1013951414pectin methylesterase 1 [Prunus persica]
RefSeqNP_180212.103039529418pectinesterase family protein [Arabidopsis thaliana]
RefSeqXP_002273535.1023953400PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002326320.101539516408predicted protein [Populus trichocarpa]
RefSeqXP_002516192.103139537414Pectinesterase PPE8B precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1xg2_A02173957185B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB1gq8_A02153949188A Chain A, Pectin Methylesterase From Carrot
PDB1qjv_B3e-2022538118193A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
PDB1qjv_A3e-2022538118193A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
PDB2ntq_B3e-2022538118193A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
Transmembrane Domains
StartEnd
726
Signal Peptide
Cleavage Site
22
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CK287615313393330
JG622622280983630
GR714237179842620
GR7142374539830
FG6104882661463930
Orthologous Group
SpeciesID
Picea abiesMA_10433178g0010MA_130858g0010
Populus trichocarpaPotri.012G014500.2
Vitis viniferaGSVIVT01015000001GSVIVT01037352001GSVIVT01028041001GSVIVT01011699001GSVIVT01037344001
GSVIVT01015019001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny